Comparing BWI76_RS20510 FitnessBrowser__Koxy:BWI76_RS20510 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
1sz2B Crystal structure of e. Coli glucokinase in complex with glucose (see paper)
90% identity, 100% coverage: 2:321/321 of query aligns to 1:320/320 of 1sz2B
6vzzA Crystal structure of glucokinase from balamuthia mandrillaris in complex with glucose (see paper)
24% identity, 92% coverage: 3:297/321 of query aligns to 24:355/374 of 6vzzA
>BWI76_RS20510 FitnessBrowser__Koxy:BWI76_RS20510
MTKFALVGDVGGTNARLALCDLTSGEISRAKTYSGLDYPSLEAVVQVYLEEHNVQVEDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKAEHLIQFG
GAKPVEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEGIILEELRTE
LGHVSAERVLSGPGLVNLYHAIVKSDGRLPENLQPKDVTERALADTCIDCRRALSLFCVI
MGRFGGNLALTLGTFGGVYIAGGIVPRFLEFFKASGFRGGFEDKGRFKAFVQDIPVYLIV
HDNPGLLGSGAHLRQTLGQVL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory