SitesBLAST
Comparing BWI76_RS20605 FitnessBrowser__Koxy:BWI76_RS20605 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P45563 Purine nucleoside phosphorylase 2; Inosine-guanosine phosphorylase; Purine nucleoside phosphorylase II; PNP II; Xanthosine phosphorylase; EC 2.4.2.1 from Escherichia coli (strain K12) (see paper)
88% identity, 100% coverage: 1:277/277 of query aligns to 1:277/277 of P45563
- H65 (= H65) binding
- RGH 85:87 (= RGH 85:87) binding
- A117 (= A117) binding
- Y191 (= Y191) mutation to L: No detectable activity with xanthosine as substrate, but largely retains its activity against other substrates, namely inosine and guanosine, although with altered affinities, higher and lower respectively, and clearly reduced maximal velocities for both.
- E197 (= E197) binding
- S216 (= S216) binding
- N239 (= N239) binding ; mutation to D: Catalyzes the phosphorolysis of adenosine with moderate efficiency, and essentially has lost all activity against the 6-oxo-purine substrates xanthosine, inosine and guanosine.
1yr3A Escherichia coli purine nucleoside phosphorylase ii, the product of the xapa gene (see paper)
89% identity, 98% coverage: 6:277/277 of query aligns to 2:273/273 of 1yr3A
- active site: S30 (= S34), H61 (= H65), H83 (= H87), Y85 (= Y89), E86 (= E90), A113 (= A117), M211 (= M215), S212 (= S216), N235 (= N239), A237 (= A241), H247 (= H251)
- binding xanthine: A114 (= A118), E193 (= E197), G210 (= G214), N235 (= N239)
1yqqA Escherichia coli purine nucleoside phosphorylase ii, the product of the xapa gene (see paper)
89% identity, 98% coverage: 6:277/277 of query aligns to 2:273/273 of 1yqqA
- active site: S30 (= S34), H61 (= H65), H83 (= H87), Y85 (= Y89), E86 (= E90), A113 (= A117), M211 (= M215), S212 (= S216), N235 (= N239), A237 (= A241), H247 (= H251)
- binding guanine: A114 (= A118), G115 (= G119), E193 (= E197), G210 (= G214), M211 (= M215), T234 (= T238), N235 (= N239), T250 (= T254)
- binding phosphate ion: H61 (= H65), R81 (= R85), H83 (= H87), N112 (= N116), S212 (= S216)
3odgA Crystal structure of xanthosine phosphorylase bound with xanthine from yersinia pseudotuberculosis
69% identity, 98% coverage: 6:277/277 of query aligns to 2:273/273 of 3odgA
- active site: S30 (= S34), H61 (= H65), H83 (= H87), Y85 (= Y89), E86 (= E90), A113 (= A117), M211 (= M215), S212 (= S216), N235 (= N239), A237 (= A241), H247 (= H251)
- binding xanthine: A114 (= A118), G115 (= G119), F192 (= F196), E193 (= E197), G210 (= G214), M211 (= M215), T234 (= T238), N235 (= N239)
P46354 Purine nucleoside phosphorylase 1; PNP 1; Inosine phosphorylase; Inosine-guanosine phosphorylase; Purine nucleoside phosphorylase I; PNP I; Pu-NPase I; EC 2.4.2.1 from Bacillus subtilis (strain 168) (see paper)
45% identity, 93% coverage: 13:269/277 of query aligns to 8:263/271 of P46354
- S28 (= S34) modified: Phosphoserine
8swuA Structure of clostridium perfringens pnp bound to transition state analog immucillin h and sulfate (see paper)
44% identity, 95% coverage: 13:276/277 of query aligns to 11:269/269 of 8swuA
- binding 1,4-dideoxy-4-aza-1-(s)-(9-deazahypoxanthin-9-yl)-d-ribitol: Y82 (= Y89), A110 (= A117), A111 (= A118), G112 (= G119), Y189 (≠ F196), E190 (= E197), M208 (= M215), N232 (= N239), H244 (= H251), V247 (≠ T254)
4m1eB Crystal structure of purine nucleoside phosphorylase i from planctomyces limnophilus dsm 3776, nysgrc target 029364.
46% identity, 86% coverage: 26:262/277 of query aligns to 22:263/273 of 4m1eB
- active site: T30 (≠ S34), H61 (= H65), H83 (= H87), Y85 (= Y89), E86 (= E90), A113 (= A117), M211 (= M215), S212 (= S216), D235 (≠ N239), C237 (≠ A241), L247 (= L249)
- binding pyridine-2-carboxylic acid: N118 (≠ R122), Q120 (≠ E124), R169 (≠ Q173), H178 (≠ P182), P180 (≠ T184), P180 (≠ T184)
- binding adenine: A114 (= A118), G115 (= G119), E193 (= E197), V209 (= V213), D235 (≠ N239)
A4Q998 Purine nucleoside phosphorylase; AgPNP; Inosine phosphorylase; Inosine-guanosine phosphorylase; EC 2.4.2.1 from Anopheles gambiae (African malaria mosquito) (see paper)
48% identity, 80% coverage: 21:241/277 of query aligns to 85:310/353 of A4Q998
- S98 (= S34) binding
- H129 (= H65) binding
- RFH 149:151 (≠ RGH 85:87) binding
- A181 (= A117) binding
- S285 (= S216) binding
Sites not aligning to the query:
- 1:68 modified: Variant sequence, MSKFSYLQNGKASTNGVPHANGHHQQHQNGHSNGVARNGGTATDTLPVAYQQKAATSGPFHMPRTEHV -> M (in isoform 2)
2p4sA Structure of purine nucleoside phosphorylase from anopheles gambiae in complex with dadme-immh (see paper)
48% identity, 80% coverage: 21:241/277 of query aligns to 16:241/282 of 2p4sA
- active site: S29 (= S34), H60 (= H65), H82 (= H87), Y84 (= Y89), E85 (= E90), A112 (= A117), M215 (= M215), S216 (= S216), N239 (= N239), C241 (≠ A241)
- binding 7-[[(3R,4R)-3-(hydroxymethyl)-4-oxidanyl-pyrrolidin-1-ium-1-yl]methyl]-3,5-dihydropyrrolo[3,2-d]pyrimidin-4-one: Y84 (= Y89), A112 (= A117), A113 (= A118), G114 (= G119), F196 (= F196), E197 (= E197), I213 (≠ V213), G214 (= G214), M215 (= M215), N239 (= N239)
- binding phosphate ion: G28 (= G33), S29 (= S34), R80 (= R85), H82 (= H87), N111 (= N116), S216 (= S216)
Sites not aligning to the query:
3lbaA The crystal structure of smu.1229 from streptococcus mutans ua159 bound to hypoxanthine
45% identity, 91% coverage: 26:276/277 of query aligns to 22:260/260 of 3lbaA
- active site: S30 (= S34), H77 (= H87), Y79 (= Y89), E80 (= E90), A107 (= A117), M203 (= M215), S204 (= S216), N227 (= N239), A229 (= A241)
- binding hypoxanthine: A107 (= A117), A108 (= A118), G109 (= G119), Y184 (≠ F196), E185 (= E197), V201 (= V213), G202 (= G214), N227 (= N239)
8swtA Structure of bacteroides fragilis pnp bound to transition state analog immucillin h and sulfate (see paper)
39% identity, 95% coverage: 13:275/277 of query aligns to 17:277/278 of 8swtA
- binding 1,4-dideoxy-4-aza-1-(s)-(9-deazahypoxanthin-9-yl)-d-ribitol: H90 (= H87), Y92 (= Y89), A120 (= A117), S121 (≠ A118), G122 (= G119), F198 (= F196), E199 (= E197), Y204 (≠ I202), G216 (= G214), M217 (= M215), D241 (≠ N239), H253 (= H251)
3e0qC Crystal structure of schistosoma mansoni purine nucleoside phosphorylase complexed with a novel monocyclic inhibitor (see paper)
44% identity, 89% coverage: 24:269/277 of query aligns to 23:279/285 of 3e0qC
- active site: S33 (= S34), H64 (= H65), H86 (= H87), Y88 (= Y89), E89 (= E90), A116 (= A117), M219 (= M215), S220 (= S216), N243 (= N239), S245 (≠ A241), H257 (= H251)
- binding 6-amino-5-bromo-1,2,3,4-tetrahydropyrimidine-2,4-dione: A116 (= A117), G118 (= G119), Y200 (≠ F196), E201 (= E197), G218 (= G214), M219 (= M215), N243 (= N239), V260 (≠ T254)
1a9sA Bovine purine nucleoside phosphorylase complexed with inosine and sulfate (see paper)
45% identity, 88% coverage: 26:269/277 of query aligns to 25:278/282 of 1a9sA
- active site: S33 (= S34), H64 (= H65), H86 (= H87), Y88 (= Y89), E89 (= E90), A116 (= A117), M219 (= M215), S220 (= S216), N243 (= N239), V245 (vs. gap), H257 (= H251)
- binding inosine: Y88 (= Y89), A116 (= A117), G118 (= G119), F200 (= F196), E201 (= E197), M219 (= M215), T242 (= T238), N243 (= N239), H257 (= H251), V260 (≠ T254)
1a9qA Bovine purine nucleoside phosphorylase complexed with inosine (see paper)
45% identity, 88% coverage: 26:269/277 of query aligns to 25:278/282 of 1a9qA
- active site: S33 (= S34), H64 (= H65), H86 (= H87), Y88 (= Y89), E89 (= E90), A116 (= A117), M219 (= M215), S220 (= S216), N243 (= N239), V245 (vs. gap), H257 (= H251)
- binding hypoxanthine: A117 (= A118), G118 (= G119), F200 (= F196), E201 (= E197), M219 (= M215), N243 (= N239)
1a9tA Bovine purine nucleoside phosphorylase complexed with 9-deazainosine and phosphate (see paper)
45% identity, 88% coverage: 26:269/277 of query aligns to 25:278/284 of 1a9tA
- active site: S33 (= S34), H64 (= H65), H86 (= H87), Y88 (= Y89), E89 (= E90), A116 (= A117), M219 (= M215), S220 (= S216), N243 (= N239), V245 (vs. gap), H257 (= H251)
- binding hypoxanthine: A116 (= A117), A117 (= A118), G118 (= G119), F200 (= F196), E201 (= E197), V217 (= V213), N243 (= N239)
- binding 1-O-phosphono-alpha-D-ribofuranose: S33 (= S34), R84 (= R85), H86 (= H87), Y88 (= Y89), N115 (= N116), A116 (= A117), F200 (= F196), M219 (= M215), S220 (= S216), V260 (≠ T254)
1a9pA Bovine purine nucleoside phosphorylase complexed with 9-deazainosine and phosphate (see paper)
45% identity, 88% coverage: 26:269/277 of query aligns to 25:278/289 of 1a9pA
- active site: S33 (= S34), H64 (= H65), H86 (= H87), Y88 (= Y89), E89 (= E90), A116 (= A117), M219 (= M215), S220 (= S216), N243 (= N239), V245 (vs. gap), H257 (= H251)
- binding 9-deazainosine: H86 (= H87), Y88 (= Y89), A116 (= A117), G118 (= G119), F200 (= F196), E201 (= E197), M219 (= M215), N243 (= N239), H257 (= H251), E259 (≠ Q253)
- binding phosphate ion: G32 (= G33), S33 (= S34), H64 (= H65), R84 (= R85), H86 (= H87), N115 (= N116), S220 (= S216)
1a9oA Bovine purine nucleoside phosphorylase complexed with phosphate (see paper)
45% identity, 88% coverage: 26:269/277 of query aligns to 25:278/289 of 1a9oA
- active site: S33 (= S34), H64 (= H65), H86 (= H87), Y88 (= Y89), E89 (= E90), A116 (= A117), M219 (= M215), S220 (= S216), N243 (= N239), V245 (vs. gap), H257 (= H251)
- binding phosphate ion: G32 (= G33), R84 (= R85), N115 (= N116), S220 (= S216)
1b8oA Purine nucleoside phosphorylase (see paper)
45% identity, 88% coverage: 26:269/277 of query aligns to 23:276/280 of 1b8oA
- active site: S31 (= S34), H62 (= H65), H84 (= H87), Y86 (= Y89), E87 (= E90), A114 (= A117), M217 (= M215), S218 (= S216), N241 (= N239), V243 (vs. gap), H255 (= H251)
- binding 1,4-dideoxy-4-aza-1-(s)-(9-deazahypoxanthin-9-yl)-d-ribitol: H84 (= H87), Y86 (= Y89), A114 (= A117), G116 (= G119), F198 (= F196), E199 (= E197), M217 (= M215), N241 (= N239), H255 (= H251), V258 (≠ T254)
- binding phosphate ion: G30 (= G33), S31 (= S34), R82 (= R85), H84 (= H87), N113 (= N116), S218 (= S216)
1b8nA Purine nucleoside phosphorylase (see paper)
45% identity, 88% coverage: 26:269/277 of query aligns to 24:277/278 of 1b8nA
- active site: S32 (= S34), H63 (= H65), H85 (= H87), Y87 (= Y89), E88 (= E90), A115 (= A117), M218 (= M215), S219 (= S216), N242 (= N239), V244 (vs. gap), H256 (= H251)
- binding 1,4-dideoxy-1,4-imino-1-(s)-(9-deazaguanin-9-yl)-d-ribitol: H85 (= H87), Y87 (= Y89), A115 (= A117), G117 (= G119), F199 (= F196), E200 (= E197), V216 (= V213), G217 (= G214), M218 (= M215), N242 (= N239), H256 (= H251), V259 (≠ T254)
P55859 Purine nucleoside phosphorylase; PNP; Inosine phosphorylase; Inosine-guanosine phosphorylase; EC 2.4.2.1 from Bos taurus (Bovine) (see paper)
45% identity, 88% coverage: 26:269/277 of query aligns to 25:278/289 of P55859
- S33 (= S34) binding
- H64 (= H65) binding
- RFH 84:86 (≠ RGH 85:87) binding
- Y88 (= Y89) binding
- A116 (= A117) binding
- E201 (= E197) binding
- M219 (= M215) binding
- S220 (= S216) binding
- N243 (= N239) binding
- H257 (= H251) binding
Query Sequence
>BWI76_RS20605 FitnessBrowser__Koxy:BWI76_RS20605
MSDTLFSQNPWYSADIIRGYKPDFTPRVAFILGSGLGALAEQIEDAVAISYEKLPGFPVS
TVHGHAGELVLGNLAGVPVACMKGRGHFYEGRGMPVMTDAIRTLKLLGCELLFCTNAAGS
LRPEVGPGSLVALSDHINTMPGTPMVGPNDERFGERFFSLANAYDADYRAVLQSVAAEEG
FPLTEGVFVSYPGPNFETAAEIRMMQIIGGDVVGMSVVPEVITARHCGLKVVAVSAITNL
AEGLGDVKLSHAQTLAAAELSRQNFINLICGFLRKLA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory