SitesBLAST
Comparing BWI76_RS21240 FitnessBrowser__Koxy:BWI76_RS21240 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1gvhA The x-ray structure of ferric escherichia coli flavohemoglobin reveals an unespected geometry of the distal heme pocket (see paper)
86% identity, 100% coverage: 1:396/396 of query aligns to 1:396/396 of 1gvhA
- binding flavin-adenine dinucleotide: S46 (= S46), Q48 (= Q48), N50 (= N50), Y188 (= Y188), R204 (= R204), Q205 (= Q205), Y206 (= Y206), S207 (= S207), A220 (= A220), V221 (= V221), E224 (= E224), G227 (= G227), Q228 (= Q228), V229 (= V229), S230 (= S230), V269 (= V269), T272 (= T272), E388 (= E388), F390 (= F390)
- binding protoporphyrin ix containing fe: F43 (= F43), Q53 (= Q53), A56 (= A56), L57 (= L57), A60 (= A60), I61 (= I61), I81 (= I81), K84 (= K84), H85 (= H85), I90 (= I90), Q94 (= Q94), Y95 (= Y95), L127 (= L127), F131 (= F131), H393 (= H393)
P24232 Flavohemoprotein; Flavohemoglobin; HMP; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Escherichia coli (strain K12) (see 2 papers)
86% identity, 100% coverage: 1:396/396 of query aligns to 1:396/396 of P24232
- Y29 (= Y29) mutation Y->E,H: 15 to 35-fold reduction in NO dioxygenase activity.; mutation to F: 30-fold reduction in NO dioxygenase activity, and 80-fold increase in the O(2) dissociation rate constant.
- Y95 (= Y95) active site, Charge relay system
- E135 (= E135) active site, Charge relay system
3ozwA The crystal structure of flavohemoglobin from r. Eutrophus in complex with ketoconazole (see paper)
44% identity, 99% coverage: 1:392/396 of query aligns to 1:398/403 of 3ozwA
- binding flavin-adenine dinucleotide: A46 (≠ S46), Q50 (≠ N50), R206 (= R204), Q207 (= Q205), Y208 (= Y206), S209 (= S207), S222 (≠ A220), V223 (= V221), K224 (= K222), E226 (= E224), P232 (vs. gap), G234 (= G227), Y235 (≠ Q228), V236 (= V229), S237 (= S230), V276 (= V269), T279 (= T272), V395 (≠ C389), F396 (= F390)
- binding protoporphyrin ix containing fe: V42 (≠ I42), F43 (= F43), I81 (= I81), H85 (= H85), L88 (≠ F88), V90 (≠ I90), Q94 (= Q94), Y95 (= Y95), V98 (= V98), Y126 (= Y124), A130 (= A128), L133 (≠ F131)
- binding 1-acetyl-4-(4-{[(2R,4S)-2-(2,4-dichlorophenyl)-2-(1H-imidazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy}phenyl)piperazine: Q53 (= Q53), A56 (= A56), L102 (= L102), P398 (= P392)
3ozvA The crystal structure of flavohemoglobin from r. Eutrophus in complex with econazole (see paper)
44% identity, 99% coverage: 1:392/396 of query aligns to 1:398/403 of 3ozvA
- binding 1-[(2s)-2-[(4-chlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1h-imidazole: I24 (≠ L24), F28 (= F28), L57 (= L57), L102 (= L102), I106 (≠ L106)
- binding flavin-adenine dinucleotide: N44 (= N44), A46 (≠ S46), Q48 (= Q48), R206 (= R204), Q207 (= Q205), Y208 (= Y206), S209 (= S207), S222 (≠ A220), V223 (= V221), K224 (= K222), E226 (= E224), P232 (vs. gap), G234 (= G227), Y235 (≠ Q228), V236 (= V229), S237 (= S230), V276 (= V269), T279 (= T272), F396 (= F390)
- binding protoporphyrin ix containing fe: F43 (= F43), I81 (= I81), K84 (= K84), H85 (= H85), L88 (≠ F88), V90 (≠ I90), Q94 (= Q94), Y95 (= Y95), V98 (= V98), Y126 (= Y124), A130 (= A128), L133 (≠ F131)
3ozuA The crystal structure of flavohemoglobin from r. Eutrophus in complex with miconazole (see paper)
44% identity, 99% coverage: 1:392/396 of query aligns to 1:398/403 of 3ozuA
- binding flavin-adenine dinucleotide: A46 (≠ S46), H47 (≠ N47), R206 (= R204), Q207 (= Q205), Y208 (= Y206), S209 (= S207), S222 (≠ A220), V223 (= V221), K224 (= K222), E226 (= E224), P232 (vs. gap), G234 (= G227), Y235 (≠ Q228), V236 (= V229), S237 (= S230), E394 (= E388), V395 (≠ C389), G397 (= G391), P398 (= P392)
- binding protoporphyrin ix containing fe: F43 (= F43), N44 (= N44), I81 (= I81), H85 (= H85), L88 (≠ F88), V90 (≠ I90), Q94 (= Q94), Y95 (= Y95), V98 (= V98), Y126 (= Y124), L129 (= L127), A130 (= A128), L133 (≠ F131)
- binding 1-[(2R)-2-[(2,4-dichlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1H-imidazole: I25 (≠ T25), F28 (= F28), F43 (= F43), A56 (= A56), L57 (= L57), L102 (= L102), W122 (= W120), A125 (= A123), Y126 (= Y124)
P39662 Flavohemoprotein; FHP; Flavohemoglobin; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
44% identity, 99% coverage: 1:392/396 of query aligns to 1:398/403 of P39662
- A60 (= A60) mutation to Y: Does not affect phospholipid-binding.
- V98 (= V98) mutation to F: Blocks phospholipid-binding.
1cqxA Crystal structure of the flavohemoglobin from alcaligenes eutrophus at 1.75 a resolution (see paper)
44% identity, 99% coverage: 1:392/396 of query aligns to 1:398/403 of 1cqxA
- binding flavin-adenine dinucleotide: A46 (≠ S46), H47 (≠ N47), Y190 (= Y188), R206 (= R204), Q207 (= Q205), Y208 (= Y206), S209 (= S207), S222 (≠ A220), E226 (= E224), Q231 (vs. gap), P232 (vs. gap), G234 (= G227), Y235 (≠ Q228), V236 (= V229), S237 (= S230), V395 (≠ C389), G397 (= G391), P398 (= P392)
- binding protoporphyrin ix containing fe: F43 (= F43), N44 (= N44), I81 (= I81), H85 (= H85), L88 (≠ F88), V90 (≠ I90), Q94 (= Q94), Y95 (= Y95), V98 (= V98), Y126 (= Y124), L129 (= L127), A130 (= A128), L133 (≠ F131)
4g1bA X-ray structure of yeast flavohemoglobin in complex with econazole (see paper)
35% identity, 99% coverage: 1:392/396 of query aligns to 1:392/398 of 4g1bA
- binding 1-[(2s)-2-[(4-chlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1h-imidazole: F28 (= F28), Y29 (= Y29), A56 (= A56), L57 (= L57), T60 (≠ A60), L102 (= L102), Y126 (= Y124)
- binding flavin-adenine dinucleotide: T46 (≠ S46), V50 (≠ N50), K84 (= K84), Y189 (= Y188), R207 (= R204), H208 (≠ Q205), Y209 (= Y206), S210 (= S207), A223 (= A220), K225 (= K222), E227 (vs. gap), F233 (vs. gap), P234 (vs. gap), G236 (= G227), L237 (≠ Q228), V238 (= V229), S239 (= S230), V282 (= V269), F390 (= F390)
- binding protoporphyrin ix containing fe: I42 (= I42), F43 (= F43), N44 (= N44), N47 (= N47), T60 (≠ A60), Q80 (≠ K80), I81 (= I81), K84 (= K84), H85 (= H85), L88 (≠ F88), I90 (= I90), H94 (≠ Q94), Y95 (= Y95), V98 (= V98), F133 (= F131), P392 (= P392)
Sites not aligning to the query:
4eh1A Crystal structure of the flavohem-like-fad/NAD binding domain of nitric oxide dioxygenase from vibrio cholerae o1 biovar el tor
47% identity, 61% coverage: 153:392/396 of query aligns to 4:237/237 of 4eh1A
- binding flavin-adenine dinucleotide: Y39 (= Y188), R55 (= R204), Q56 (= Q205), Y57 (= Y206), S58 (= S207), S71 (≠ A220), V72 (= V221), E75 (= E224), N81 (= N225), G83 (= G227), L84 (≠ Q228), V85 (= V229), S86 (= S230), T127 (= T272), E233 (= E388), F235 (= F390)
6o0aA Crystal structure of flavohemoglobin from malassezia yamatoensis with bound fad and heme determined by iron sad phasing (see paper)
29% identity, 98% coverage: 2:391/396 of query aligns to 3:383/383 of 6o0aA
- binding flavin-adenine dinucleotide: S48 (= S46), R51 (= R49), D52 (≠ N50), Y190 (= Y188), R205 (= R204), Q206 (= Q205), F207 (≠ Y206), T208 (≠ S207), K222 (= K222), D224 (≠ E224), H226 (≠ G226), G227 (= G227), E228 (≠ Q228), M229 (≠ V229), T230 (≠ S230), T274 (= T272), E380 (= E388), F382 (= F390), G383 (= G391)
- binding protoporphyrin ix containing fe: M44 (≠ I42), F45 (= F43), S46 (≠ N44), L59 (= L57), S62 (≠ A60), R84 (≠ K80), V85 (≠ I81), H89 (= H85), L92 (≠ F88), L94 (≠ I90), E98 (≠ Q94), Y99 (= Y95), V102 (= V98), Y130 (= Y124), L133 (= L127)
Q03331 Flavohemoprotein; Flavohemoglobin; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Candida norvegensis (Yeast) (Candida mycoderma) (see paper)
27% identity, 99% coverage: 2:392/396 of query aligns to 13:385/390 of Q03331
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylserine
3tm9A Y29a mutant of vitreoscilla stercoraria hemoglobin (see paper)
45% identity, 36% coverage: 1:142/396 of query aligns to 1:144/146 of 3tm9A
- binding protoporphyrin ix containing fe: L42 (≠ I42), F43 (= F43), Q53 (= Q53), L57 (= L57), T60 (≠ A60), I81 (= I81), K84 (= K84), H85 (= H85), V90 (≠ I90), Y95 (= Y95), V98 (= V98), Y126 (= Y124), F133 (= F131)
4vhbA Thiocyanate adduct of the bacterial hemoglobin from vitreoscilla sp. (see paper)
44% identity, 36% coverage: 1:142/396 of query aligns to 1:136/138 of 4vhbA
- binding protoporphyrin ix containing fe: L42 (≠ I42), F43 (= F43), L49 (= L57), T52 (≠ A60), I73 (= I81), K76 (= K84), H77 (= H85), V82 (≠ I90), H86 (≠ Q94), Y87 (= Y95), V90 (= V98), F125 (= F131)
- binding thiocyanate ion: F28 (= F28), L49 (= L57)
3vhbA Imidazole adduct of the bacterial hemoglobin from vitreoscilla sp. (see paper)
44% identity, 36% coverage: 2:142/396 of query aligns to 1:134/135 of 3vhbA
- binding protoporphyrin ix containing fe: F42 (= F43), L47 (= L57), T50 (≠ A60), I71 (= I81), K74 (= K84), H75 (= H85), V80 (≠ I90), H84 (≠ Q94), Y85 (= Y95), V88 (= V98), Y116 (= Y124), F123 (= F131)
- binding imidazole: Y28 (= Y29), L47 (= L57)
7dihA Crystal structure of thermoglobin y29f mutant in complex with imidazole
38% identity, 36% coverage: 1:141/396 of query aligns to 1:138/139 of 7dihA
- binding protoporphyrin ix containing fe: L42 (≠ I42), F43 (= F43), A46 (≠ S46), S47 (≠ N47), Q50 (= Q53), L54 (= L57), I78 (= I81), S81 (≠ K84), H82 (= H85), V87 (≠ I90), H91 (≠ Q94), Y92 (= Y95), V95 (= V98), Y121 (= Y124), L124 (= L127)
2wy4A Structure of bacterial globin from campylobacter jejuni at 1.35 a resolution (see paper)
37% identity, 35% coverage: 5:141/396 of query aligns to 3:139/139 of 2wy4A
- binding protoporphyrin ix containing fe: M40 (≠ I42), F41 (= F43), N42 (= N44), Q51 (= Q53), L55 (= L57), A58 (= A60), V79 (≠ I81), T82 (≠ K84), H83 (= H85), L86 (≠ F88), V88 (≠ I90), H92 (≠ Q94), Y93 (= Y95), V96 (= V98), Y129 (≠ F131)
1krhA X-ray structure of benzoate dioxygenase reductase (see paper)
27% identity, 56% coverage: 169:390/396 of query aligns to 124:334/337 of 1krhA
- active site: C306 (= C362)
- binding flavin-adenine dinucleotide: Y143 (= Y188), R155 (= R204), S156 (≠ Q205), Y157 (= Y206), S158 (= S207), V171 (≠ A220), V172 (= V221), G178 (= G227), K179 (≠ Q228), M180 (≠ V229), S181 (= S230), T219 (≠ V269), E332 (= E388), F334 (= F390)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 335, 336, 337
- binding fe2/s2 (inorganic) cluster: 38, 39, 40, 41, 43, 45, 46, 48, 82
7ylrA Structure of a bacteria protein
27% identity, 60% coverage: 152:390/396 of query aligns to 5:231/326 of 7ylrA
- binding flavin mononucleotide: R56 (= R204), H57 (≠ Q205), Y58 (= Y206), S59 (= S207), A79 (= A220), V80 (= V221), R81 (≠ K222), G86 (= G227), R87 (≠ Q228), G89 (vs. gap), S90 (= S230), T131 (= T272), E229 (= E388), F231 (= F390)
Sites not aligning to the query:
6wk3D Engineered carbene transferase rmanod q52v, putative nitric oxide dioxygenase from rhodothermus marinus (see paper)
29% identity, 35% coverage: 2:139/396 of query aligns to 6:141/146 of 6wk3D
- binding copper (ii) ion: E51 (≠ N47), H55 (≠ G51)
- binding protoporphyrin ix containing fe: L46 (≠ I42), F47 (= F43), L57 (= L57), R80 (≠ K80), M81 (≠ I81), S84 (≠ K84), H85 (= H85), R87 (≠ S87), A88 (≠ F88), V90 (≠ I90), H94 (≠ Q94), Y95 (= Y95), V98 (= V98), Y126 (= Y124)
7qu3A X-ray structure of fad domain of nqrf of pseudomonas aeruginosa (see paper)
27% identity, 48% coverage: 203:391/396 of query aligns to 82:279/279 of 7qu3A
- binding flavin-adenine dinucleotide: R83 (= R204), A84 (≠ Q205), Y85 (= Y206), S86 (= S207), N100 (vs. gap), A104 (= A220), S105 (≠ V221), L112 (vs. gap), P113 (vs. gap), G115 (= G227), Q116 (= Q228), M117 (≠ V229), S118 (= S230), A155 (≠ V269), F278 (= F390)
- binding 4-(benzimidazol-1-ylmethyl)benzenecarbonitrile: R102 (= R218), G154 (= G268), G182 (≠ A295), F226 (= F337), I227 (≠ D338), P252 (= P364), M255 (≠ F367)
Sites not aligning to the query:
Query Sequence
>BWI76_RS21240 FitnessBrowser__Koxy:BWI76_RS21240
MLDAQTIATVKATIPLLVETGPKLTAHFYDRMFAHNPELKEIFNMSNQRNGDQREALFNA
IAAYASNLENLPALLPAVEKIAQKHTSFQIQPEQYNIVGTHLLATLDEMFSPGQEVLDAW
GKAYGILANVFINREAQIYNESASKTGGWEGTRAFRIVKKTPRSALITSFEFEPVDGGAV
AEYHPGQYLAVWLKPEGFPHQEIRQYSLTRKPDGKGYRIAVKRENGGQVSNWLHDSAKEG
DVVYLAAPAGDFFLNVAPETPVTLLSGGVGQTPMLAMLDVLAKAQHPAQVNWFHAAENGD
VHAFADEVKALGETLPKFTSHVWYRSPSEADRQADAFDSEGLMDLSALADKIGDPQMQFY
LCGPVAFMQFAAQQLVELGVNKDNIHYECFGPHKVL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory