Comparing BWI76_RS21760 FitnessBrowser__Koxy:BWI76_RS21760 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7pldB Caulobacter crescentus xylonolactonase with (r)-4-hydroxy-2- pyrrolidone (see paper)
30% identity, 87% coverage: 7:256/286 of query aligns to 10:258/289 of 7pldB
7plbB Caulobacter crescentus xylonolactonase with d-xylose (see paper)
30% identity, 87% coverage: 7:256/286 of query aligns to 10:258/289 of 7plbB
Q9A9Z1 D-xylonolactone lactonase; Xylono-1,5-lactonase; EC 3.1.1.110 from Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) (see paper)
30% identity, 87% coverage: 7:256/286 of query aligns to 10:258/289 of Q9A9Z1
4gnaA Mouse smp30/gnl-xylitol complex (see paper)
27% identity, 85% coverage: 13:256/286 of query aligns to 15:266/297 of 4gnaA
4gn9A Mouse smp30/gnl-glucose complex (see paper)
27% identity, 85% coverage: 13:256/286 of query aligns to 15:266/297 of 4gn9A
4gn8A Mouse smp30/gnl-1,5-ag complex (see paper)
27% identity, 85% coverage: 13:256/286 of query aligns to 15:266/297 of 4gn8A
Sites not aligning to the query:
4gn7A Mouse smp30/gnl (see paper)
27% identity, 85% coverage: 13:256/286 of query aligns to 15:266/297 of 4gn7A
4gncA Human smp30/gnl-1,5-ag complex (see paper)
26% identity, 85% coverage: 13:255/286 of query aligns to 16:266/298 of 4gncA
Sites not aligning to the query:
3g4hA Crystal structure of human senescence marker protein-30 (zinc bound) (see paper)
26% identity, 85% coverage: 13:255/286 of query aligns to 15:265/297 of 3g4hA
Q15493 Regucalcin; RC; Gluconolactonase; GNL; Senescence marker protein 30; SMP-30; EC 3.1.1.17 from Homo sapiens (Human) (see 2 papers)
26% identity, 85% coverage: 13:255/286 of query aligns to 17:267/299 of Q15493
5gx1A Luciferin-regenerating enzyme collected with serial synchrotron rotational crystallography with accumulated dose of 1.1 mgy (1st measurement) (see paper)
28% identity, 98% coverage: 3:282/286 of query aligns to 6:301/307 of 5gx1A
5d9bA Luciferin-regenerating enzyme solved by siras using xfel (refined against native data) (see paper)
28% identity, 98% coverage: 3:282/286 of query aligns to 6:301/307 of 5d9bA
3dr2A Structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways (see paper)
25% identity, 78% coverage: 14:235/286 of query aligns to 45:276/299 of 3dr2A
7zqgA Crystal structure of pizza6-ksh-tsh with silicotungstic acid (sta) polyoxometalate
29% identity, 44% coverage: 125:249/286 of query aligns to 74:194/247 of 7zqgA
Sites not aligning to the query:
6qsfA Crystal structure of pizza6s in the presence of keggin (sta) (see paper)
29% identity, 44% coverage: 125:249/286 of query aligns to 33:153/248 of 6qsfA
Sites not aligning to the query:
6qshA Crystal structure of the hybrid bioinorganic complex of pizza6s linked by the 1:2 ce-substituted keggin (see paper)
29% identity, 44% coverage: 125:249/286 of query aligns to 72:192/246 of 6qshA
Sites not aligning to the query:
6rekA Crystal structure of pizza6-sh with cu2+ (see paper)
29% identity, 44% coverage: 125:249/286 of query aligns to 35:155/251 of 6rekA
Sites not aligning to the query:
7ov7A The hybrid cage formed between pizza6-s and cu(ii)-substituted trilacunary keggin
29% identity, 44% coverage: 125:249/286 of query aligns to 35:155/250 of 7ov7A
Sites not aligning to the query:
6qseA Crystal structure of pizza6s in the presence of anderson-evans (tew) (see paper)
29% identity, 44% coverage: 125:249/286 of query aligns to 35:155/251 of 6qseA
Sites not aligning to the query:
6rejA Crystal structure of pizza6-sh with zn2+ (see paper)
29% identity, 44% coverage: 125:249/286 of query aligns to 34:154/250 of 6rejA
Sites not aligning to the query:
>BWI76_RS21760 FitnessBrowser__Koxy:BWI76_RS21760
MFSVAADARNLLGECPIWCERTRRIYWTDIEGCELLALEEDSSVVMRWSLPERLGSFALT
ENSDVLLMGLASRFAFCDLNTGIFTPVVASPGGPGTRTGDGRCDREGNFVFGTMDDGYPA
KVIGRFHRLNAATLSIETLPLPEVAIPNSICFSPDGSTMYYCDSMQGRIMCCDYPSMNNQ
RVFTATEGNGAPDGSCVDALGYVWNAEWGGSRVVRYRPDGTTESILPSPGVQSTCPTLAG
EAFTTLYCTSASVGLSVPSRHDGALLRAESAVFPGLPESRFSAHTA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory