Comparing BWI76_RS21950 FitnessBrowser__Koxy:BWI76_RS21950 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
35% identity, 88% coverage: 23:249/257 of query aligns to 3:227/229 of 5t0wA
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
27% identity, 81% coverage: 30:238/257 of query aligns to 4:210/234 of 3k4uE
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
30% identity, 86% coverage: 30:249/257 of query aligns to 4:222/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
30% identity, 86% coverage: 30:249/257 of query aligns to 4:224/226 of 4zv1A
5kkwA Crystal structure of sar11_1068 bound to a sulfobetaine (3-(1- methylpiperidinium-1-yl)propane-1-sulfonate)
25% identity, 85% coverage: 23:240/257 of query aligns to 4:218/237 of 5kkwA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
27% identity, 88% coverage: 23:249/257 of query aligns to 3:226/229 of 6svfA
2ylnA Crystal structure of the l-cystine solute receptor of neisseria gonorrhoeae in the closed conformation (see paper)
28% identity, 69% coverage: 23:200/257 of query aligns to 7:179/240 of 2ylnA
6detA The crystal structure of tv2483 bound to l-arginine (see paper)
26% identity, 87% coverage: 26:249/257 of query aligns to 9:231/243 of 6detA
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
38% identity, 35% coverage: 19:108/257 of query aligns to 2:93/237 of 3vv5A
Sites not aligning to the query:
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
38% identity, 35% coverage: 19:108/257 of query aligns to 6:97/241 of 3vvfA
Sites not aligning to the query:
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
38% identity, 35% coverage: 19:108/257 of query aligns to 6:97/241 of 3vveA
Sites not aligning to the query:
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
38% identity, 35% coverage: 19:108/257 of query aligns to 6:97/241 of 3vvdA
Sites not aligning to the query:
7a99B Crystal structure of the phe57trp mutant of the arginine-bound form of domain 1 from tmargbp (see paper)
36% identity, 35% coverage: 23:112/257 of query aligns to 2:91/130 of 7a99B
Sites not aligning to the query:
4h5fA Crystal structure of an amino acid abc transporter substrate-binding protein from streptococcus pneumoniae canada mdr_19a bound to l- arginine, form 1
28% identity, 57% coverage: 23:169/257 of query aligns to 4:151/240 of 4h5fA
Sites not aligning to the query:
5itoA Structure of the periplasmic binding protein m117n-noct from a. Tumefaciens in complex with octopine (see paper)
26% identity, 56% coverage: 32:174/257 of query aligns to 5:166/255 of 5itoA
Sites not aligning to the query:
8gtuA Crystal structure of putative amino acid binding periplasmic abc transporter protein from candidatus liberibacter asiaticus in complex with clidinium (see paper)
26% identity, 81% coverage: 32:239/257 of query aligns to 5:208/236 of 8gtuA
8gu1A Crystal structure of putative amino acid binding periplasmic abc transporter protein from candidatus liberibacter asiaticus in complex with pimozide (see paper)
26% identity, 81% coverage: 32:239/257 of query aligns to 3:206/234 of 8gu1A
6aalA Crystal structure of putative amino acid binding periplasmic abc transporter protein from candidatus liberibacter asiaticus in complex with arginine (see paper)
26% identity, 81% coverage: 32:239/257 of query aligns to 3:206/234 of 6aalA
6a80A Crystal structure of putative amino acid binding periplasmic abc transporter protein from candidatus liberibacter asiaticus in complex with cystine (see paper)
26% identity, 81% coverage: 32:239/257 of query aligns to 3:206/234 of 6a80A
5otcA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with noroctopinic acid. (see paper)
26% identity, 56% coverage: 32:174/257 of query aligns to 4:165/256 of 5otcA
Sites not aligning to the query:
>BWI76_RS21950 FitnessBrowser__Koxy:BWI76_RS21950
MKLKSGLAFIIAAIAFGAQARDMNSIQQSGELKVGVPGDYAPLAFHNKAGELLGYDVDMA
KDLGKRLGLKVRFVPTSWPTLSADLQADKFDIAMGGVTETAARAKDFALSQPVVPNGKIA
LANCASAPALGSLEKIDQPNVKVVVNPGGTNQSFVDEHIKHAQIIRVKNNIDNLEALRQK
TADMMVTDLIEGVYYQSNEPGVFCVANETPFPGTASFKVYMMNKDNPQLLEKVNQWLASQ
DKNVLKQKWRIHDQVKP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory