SitesBLAST
Comparing BWI76_RS22295 FitnessBrowser__Koxy:BWI76_RS22295 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4f66A The crystal structure of 6-phospho-beta-glucosidase from streptococcus mutans ua159 in complex with beta-d-glucose-6-phosphate. (see paper)
51% identity, 100% coverage: 1:473/474 of query aligns to 2:478/478 of 4f66A
- active site: R86 (= R89), H131 (= H134), E177 (= E180), N180 (≠ I183), S312 (= S309), Y314 (= Y311), E376 (= E372)
- binding 6-O-phosphono-beta-D-glucopyranose: Q19 (= Q18), H131 (= H134), F132 (= F135), E177 (= E180), Y314 (= Y311), W350 (= W346), E376 (= E372), W424 (= W419), S431 (= S426), A432 (= A427), G433 (≠ S428), K439 (= K434), Y441 (= Y436)
4f79A The crystal structure of 6-phospho-beta-glucosidase mutant (e375q) in complex with salicin 6-phosphate (see paper)
51% identity, 100% coverage: 1:473/474 of query aligns to 2:478/478 of 4f79A
- active site: R86 (= R89), H131 (= H134), E177 (= E180), N180 (≠ I183), S312 (= S309), Y314 (= Y311), Q376 (≠ E372)
- binding 2-(hydroxymethyl)phenyl 6-O-phosphono-beta-D-glucopyranoside: Q19 (= Q18), H131 (= H134), F132 (= F135), E177 (= E180), Y314 (= Y311), W350 (= W346), Q376 (≠ E372), W424 (= W419), S431 (= S426), A432 (= A427), G433 (≠ S428), K439 (= K434), Y441 (= Y436)
4gpnB The crystal structure of 6-p-beta-d-glucosidase (e375q mutant) from streptococcus mutans ua150 in complex with gentiobiose 6-phosphate. (see paper)
50% identity, 100% coverage: 2:473/474 of query aligns to 1:476/476 of 4gpnB
- active site: R84 (= R89), H129 (= H134), E175 (= E180), N178 (≠ I183), S310 (= S309), Y312 (= Y311), Q374 (≠ E372)
- binding 6-O-phosphono-beta-D-glucopyranose: Q17 (= Q18), H129 (= H134), F130 (= F135), E175 (= E180), Y312 (= Y311), W348 (= W346), Q374 (≠ E372), W422 (= W419), S429 (= S426), A430 (= A427), G431 (≠ S428), K437 (= K434), Y439 (= Y436)
- binding beta-D-glucopyranose: E175 (= E180), W348 (= W346)
4ipnE The complex structure of 6-phospho-beta-glucosidase bgla-2 with thiocellobiose-6p from streptococcus pneumoniae (see paper)
51% identity, 100% coverage: 2:473/474 of query aligns to 1:462/463 of 4ipnE
4ipnB The complex structure of 6-phospho-beta-glucosidase bgla-2 with thiocellobiose-6p from streptococcus pneumoniae (see paper)
51% identity, 100% coverage: 2:473/474 of query aligns to 1:456/457 of 4ipnB
- active site: R79 (= R89), H124 (= H134), E170 (= E180), S173 (≠ I183), S300 (= S309), Y302 (= Y311), E351 (= E372)
- binding 6-O-phosphono-alpha-L-idopyranose: Q17 (= Q18), H124 (= H134), N169 (= N179), E351 (= E372), W402 (= W419), S409 (= S426), M410 (≠ A427), S411 (= S428)
- binding 4-thio-beta-D-glucopyranose: Y125 (≠ F135), E170 (= E180), S173 (≠ I183)
3qomA Crystal structure of 6-phospho-beta-glucosidase from lactobacillus plantarum (see paper)
49% identity, 99% coverage: 4:473/474 of query aligns to 9:478/479 of 3qomA
- active site: R90 (= R89), H135 (= H134), E181 (= E180), N184 (≠ I183), S316 (= S309), Y318 (= Y311), E376 (= E372)
- binding beta-D-glucopyranose: E181 (= E180), N184 (≠ I183), A244 (= A238), R268 (≠ N262), W350 (= W346)
- binding phosphate ion: Y28 (≠ W23), H65 (= H64), H202 (≠ F196), P204 (≠ E198), G205 (= G199), W350 (= W346), A431 (≠ S426), A432 (= A427), S433 (= S428), K439 (= K434), Y441 (= Y436)
4zfmC Structure of gan1d-e170q in complex with cellobiose-6-phosphate
40% identity, 100% coverage: 1:473/474 of query aligns to 2:461/461 of 4zfmC
- active site: R76 (= R89), H120 (= H134), Q166 (≠ E180), I169 (= I183), N295 (≠ S309), Y297 (= Y311), E361 (= E372)
- binding 1,5-anhydro-6-O-phosphono-D-glucitol: Q19 (= Q18), H120 (= H134), Q166 (≠ E180), E361 (= E372), W408 (= W419), S415 (= S426), W416 (≠ A427), Y424 (= Y436)
- binding beta-D-glucopyranose: Q166 (≠ E180), Y297 (= Y311)
8b80A The structure of gan1d w433a in complex with galactose-6p
39% identity, 100% coverage: 1:473/474 of query aligns to 2:474/474 of 8b80A
5okbB High resolution structure of native gan1d, a putative 6-phospho-beta- galactosidase from geobacillus stearothermophilus (see paper)
39% identity, 100% coverage: 1:473/474 of query aligns to 2:474/474 of 5okbB
4zepA Structure of gan1d, a 6-phospho-beta-galactosidase from geobacillus stearothermophilus, in complex with 6-phospho-glucose
39% identity, 100% coverage: 1:473/474 of query aligns to 2:474/474 of 4zepA
- active site: R76 (= R89), H120 (= H134), E166 (= E180), I169 (= I183), N295 (≠ S309), Y297 (= Y311), E374 (= E372)
- binding 6-O-phosphono-beta-D-glucopyranose: Q19 (= Q18), E166 (= E180), Y297 (= Y311), W348 (= W346), E374 (= E372), W421 (= W419), S428 (= S426), K435 (= K434), Y437 (= Y436)
6z1mA Structure of an ancestral glycosidase (family 1) bound to heme (see paper)
36% identity, 99% coverage: 4:470/474 of query aligns to 3:422/423 of 6z1mA
- binding protoporphyrin ix containing fe: P164 (≠ I181), N165 (= N182), L194 (≠ E213), L195 (= L214), L218 (= L237), L220 (≠ G239), N244 (= N262), F247 (= F265), K253 (≠ R271), Y256 (= Y274), L288 (≠ V303), R318 (≠ M359), Y323 (= Y364)
- binding magnesium ion: H346 (≠ N388), K409 (= K457)
5yifA Pyruvylated beta-d-galactosidase from bacillus sp. Hma207, e163a mutant pyruvylated beta-d-galactose complex (see paper)
35% identity, 99% coverage: 4:473/474 of query aligns to 3:459/459 of 5yifA
- binding (2R,4aR,6R,7R,8R,8aR)-2-methyl-6,7,8-tris(oxidanyl)-4,4a,6,7,8,8a-hexahydropyrano[3,2-d][1,3]dioxine-2-carboxylic acid: Q17 (= Q18), H118 (= H134), N162 (= N179), N295 (≠ S309), Y297 (= Y311), W337 (= W346), E364 (= E372), W410 (= W419), S417 (= S426), W418 (≠ A427), K424 (= K434)
8ivyA Beta-glucosidase bgla mutant e166q in complex with glucose (see paper)
32% identity, 99% coverage: 3:470/474 of query aligns to 5:447/451 of 8ivyA
Q9FIW4 Beta-glucosidase 42; AtBGLU42; EC 3.2.1.21 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 99% coverage: 2:472/474 of query aligns to 19:485/490 of Q9FIW4
- R342 (≠ I330) Important for substrate chain length specificity; mutation R->A,Y: Highest preference on cellotetraose and cellopentaose with increased affinities at subsite (+)3.
6r4kA Structure of beta-glucosidase a from paenibacillus polymyxa complexed with a monovalent inhibitor (see paper)
32% identity, 98% coverage: 4:469/474 of query aligns to 6:442/448 of 6r4kA
- binding (2~{S},3~{S},4~{R})-2-[[4-[4-[2-[2-(2-azanylidenehydrazinyl)ethoxy]ethoxy]phenyl]-1,2,3-triazol-1-yl]methyl]pyrrolidine-3,4-diol: Q20 (= Q18), H121 (= H134), E166 (= E180), L173 (≠ H186), E352 (= E372), W398 (= W419), E405 (≠ S426), W406 (≠ A427)
6qwiA Structure of beta-glucosidase a from paenibacillus polymyxa complexed with multivalent inhibitors. (see paper)
32% identity, 98% coverage: 4:469/474 of query aligns to 6:442/448 of 6qwiA
- binding (2~{S},3~{S},4~{R})-2-[[4-[4-(2-ethoxyethoxy)phenyl]-1,2,3-triazol-1-yl]methyl]pyrrolidine-3,4-diol: Q20 (= Q18), H121 (= H134), W122 (≠ F135), E166 (= E180), L173 (≠ H186), W326 (= W346), E352 (= E372), W398 (= W419), E405 (≠ S426), W406 (≠ A427)
4ptwA Halothermothrix orenii beta-glucosidase a, 2-deoxy-2-fluoro-glucose complex (see paper)
33% identity, 98% coverage: 4:466/474 of query aligns to 3:440/445 of 4ptwA
- active site: R74 (= R89), H118 (= H134), E163 (= E180), V166 (≠ I183), N291 (≠ S309), Y293 (= Y311), E351 (= E372)
- binding 2-deoxy-2-fluoro-alpha-D-glucopyranose: Q17 (= Q18), H118 (= H134), E163 (= E180), Y293 (= Y311), E351 (= E372), W398 (= W419), E405 (≠ S426), W406 (≠ A427)
4ptvA Halothermothrix orenii beta-glucosidase a, thiocellobiose complex (see paper)
33% identity, 98% coverage: 4:466/474 of query aligns to 3:440/445 of 4ptvA
- active site: R74 (= R89), H118 (= H134), E163 (= E180), V166 (≠ I183), N291 (≠ S309), Y293 (= Y311), E351 (= E372)
- binding beta-D-glucopyranose: W324 (= W346), E405 (≠ S426), Y408 (≠ T429)
- binding 4-thio-beta-D-glucopyranose: Q17 (= Q18), H118 (= H134), E163 (= E180), Y293 (= Y311), E351 (= E372), W398 (= W419), E405 (≠ S426), W406 (≠ A427)
1bggB Glucosidase a from bacillus polymyxa complexed with gluconate (see paper)
32% identity, 98% coverage: 4:469/474 of query aligns to 5:441/447 of 1bggB
- active site: R76 (= R89), H120 (= H134), E165 (= E180), C168 (≠ S190), N293 (≠ S309), Y295 (= Y311), E351 (= E372)
- binding D-gluconic acid: Q19 (= Q18), H120 (= H134), W121 (≠ F135), N164 (= N179), E165 (= E180), Y295 (= Y311), E351 (= E372), W397 (= W419), E404 (≠ S426), W405 (≠ A427)
1e4iA 2-deoxy-2-fluoro-beta-d-glucosyl/enzyme intermediate complex of the beta-glucosidase from bacillus polymyxa (see paper)
31% identity, 98% coverage: 4:469/474 of query aligns to 5:441/447 of 1e4iA
- active site: R76 (= R89), H120 (= H134), E165 (= E180), C168 (≠ S190), N293 (≠ S309), Y295 (= Y311), E351 (= E372)
- binding 2-deoxy-2-fluoro-alpha-D-glucopyranose: Q19 (= Q18), H120 (= H134), N164 (= N179), E165 (= E180), Y295 (= Y311), E351 (= E372), W397 (= W419), E404 (≠ S426), W405 (≠ A427)
- binding 2,4-dinitrophenyl 2-deoxy-2-fluoro-beta-D-glucopyranoside: R136 (= R151), Q140 (≠ E155), V143 (≠ T158), L202 (= L219)
Query Sequence
>BWI76_RS22295 FitnessBrowser__Koxy:BWI76_RS22295
MATFPQGFLWGGALAANQSEGAWLEGGKGPTTVDMIPHGAHRLAVKLGQEKRFAPRDDEF
YPSHEAIDFYHRYKEDIALMAEMGFSVFRTSIAWSRLFPKGDEQEPNPEGIAFYRSLFEE
CKKHNIEPLVTLCHFDVPMHLVTEYGSWRNRKMVEFFTRYARTCFEAFDGLVKYWLTFNE
INIMLHSPFSGAGLVFEEGENQEQVKYQAAHHELVASALATKIAHEVNPQNQVGCMLAGG
NFYPYSCKPEDVWMALEKDRENLFFIDVQARGAYPVWAARVFREKGVTIAKEAGDDEILR
HTVDFVSFSYYASRCASAEMNAGNTSAANIVKSLKNPYIKASEWGWGIDPLGLRITMNMM
YDRYQKPLFLVENGLGARDEIDANGEINDDYRISYLREHIQAMGDAIEDGIPVMGYTSWG
CIDLVSASTGEMSKRYGFVYVDRDDAGHGTLARRRKKSFWWYKKVIASNGEDLV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory