SitesBLAST
Comparing BWI76_RS22380 FitnessBrowser__Koxy:BWI76_RS22380 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5fooA 6-phospho-beta-glucosidase (see paper)
46% identity, 98% coverage: 6:460/466 of query aligns to 4:460/463 of 5fooA
- active site: R74 (= R76), H119 (= H121), E165 (= E167), V168 (= V170), N297 (= N296), Y299 (= Y298), E366 (= E365)
- binding 6-phosphocyclophellitol: Q18 (= Q20), H119 (= H121), E165 (= E167), Y299 (= Y298), K337 (≠ D336), E366 (= E365), W416 (= W416), S423 (= S423), Y432 (= Y432)
5naqA Crystal structure of native 6-phospho-glucosidase lpbgl from lactobacillus plantarum (see paper)
46% identity, 98% coverage: 5:462/466 of query aligns to 3:461/461 of 5naqA
- active site: R74 (= R76), H119 (= H121), E165 (= E167), V168 (= V170), N296 (= N296), Y298 (= Y298), E365 (= E365)
- binding phosphate ion: R336 (≠ D336), S422 (= S423), H425 (≠ N426), N429 (≠ R430), Y431 (= Y432)
6z1mA Structure of an ancestral glycosidase (family 1) bound to heme (see paper)
38% identity, 98% coverage: 5:462/466 of query aligns to 2:423/423 of 6z1mA
- binding protoporphyrin ix containing fe: P164 (= P168), N165 (≠ I169), L194 (≠ I198), L195 (≠ M199), L218 (= L222), L220 (= L224), N244 (= N248), F247 (= F251), K253 (= K257), Y256 (≠ F260), L288 (≠ V290), R318 (≠ N351), Y323 (= Y356)
- binding magnesium ion: H346 (≠ D385), K409 (≠ R448)
4ptwA Halothermothrix orenii beta-glucosidase a, 2-deoxy-2-fluoro-glucose complex (see paper)
36% identity, 97% coverage: 6:456/466 of query aligns to 3:439/445 of 4ptwA
- active site: R74 (= R76), H118 (= H121), E163 (= E167), V166 (= V170), N291 (= N296), Y293 (= Y298), E351 (= E365)
- binding 2-deoxy-2-fluoro-alpha-D-glucopyranose: Q17 (= Q20), H118 (= H121), E163 (= E167), Y293 (= Y298), E351 (= E365), W398 (= W416), E405 (≠ S423), W406 (= W424)
4ptvA Halothermothrix orenii beta-glucosidase a, thiocellobiose complex (see paper)
36% identity, 97% coverage: 6:456/466 of query aligns to 3:439/445 of 4ptvA
- active site: R74 (= R76), H118 (= H121), E163 (= E167), V166 (= V170), N291 (= N296), Y293 (= Y298), E351 (= E365)
- binding beta-D-glucopyranose: W324 (vs. gap), E405 (≠ S423), Y408 (≠ N426)
- binding 4-thio-beta-D-glucopyranose: Q17 (= Q20), H118 (= H121), E163 (= E167), Y293 (= Y298), E351 (= E365), W398 (= W416), E405 (≠ S423), W406 (= W424)
8ivyA Beta-glucosidase bgla mutant e166q in complex with glucose (see paper)
32% identity, 99% coverage: 1:462/466 of query aligns to 1:448/451 of 8ivyA
5gnxA The e171q mutant structure of bgl6 (see paper)
34% identity, 98% coverage: 4:461/466 of query aligns to 5:446/451 of 5gnxA
3wh7A Crystal structure of gh1 beta-glucosidase td2f2 l-fucose complex (see paper)
33% identity, 97% coverage: 1:453/466 of query aligns to 1:436/443 of 3wh7A
3wh6A Crystal structure of gh1 beta-glucosidase td2f2 glucose complex (see paper)
33% identity, 97% coverage: 1:453/466 of query aligns to 1:436/443 of 3wh6A
- binding beta-D-glucopyranose: Q20 (= Q20), D28 (≠ P28), H40 (≠ E39), P42 (= P41), G48 (≠ Q47), Y58 (= Y57), H59 (= H58), H100 (≠ F100), R103 (≠ A103), H121 (= H121), E166 (= E167), Y295 (= Y298), R325 (≠ N338), E352 (= E365), W399 (= W416), E406 (≠ S423), W407 (= W424), Y415 (= Y432)
- binding alpha-D-glucopyranose: H358 (≠ E375), S412 (≠ K429), R414 (= R431)
Q75I93 Beta-glucosidase 7; Os3bglu7; EC 3.2.1.21 from Oryza sativa subsp. japonica (Rice) (see 4 papers)
33% identity, 98% coverage: 1:456/466 of query aligns to 38:501/504 of Q75I93
- E204 (= E167) active site, Proton donor
- I207 (≠ V170) mutation to V: Increases KM for substrate about 5-fold. Increases kcat/Km values 9 to 24-fold depending on the substrate.
- N218 (≠ H181) mutation to H: Decreases KM for substrate about 2-fold.
- C223 (vs. gap) modified: Disulfide link with 226
- C226 (= C184) modified: Disulfide link with 223
- N273 (≠ T225) mutation to V: Increases KM for substrate about 5-fold.
- E414 (= E365) active site, Nucleophile
- L470 (≠ I425) mutation to R: No effect on KM.
7bzmA Crystal structure of rice os3bglu7 with glucoimidazole (see paper)
32% identity, 98% coverage: 1:456/466 of query aligns to 5:468/471 of 7bzmA
- active site: R81 (= R76), H125 (= H121), E171 (= E167), I174 (≠ V170), N308 (= N296), Y310 (= Y298), E381 (= E365)
- binding glucoimidazole: Q24 (= Q20), H125 (= H121), E171 (= E167), Y310 (= Y298), W353 (vs. gap), E381 (= E365), W428 (= W416), E435 (≠ S423), F444 (≠ Y432)
- binding zinc ion: D60 (= D55), H63 (= H58)
2rglA Rice bglu1 beta-glucosidase, a plant exoglucanase/beta-glucosidase (see paper)
32% identity, 98% coverage: 1:456/466 of query aligns to 5:468/471 of 2rglA
- active site: R81 (= R76), H125 (= H121), E171 (= E167), I174 (≠ V170), N308 (= N296), Y310 (= Y298), E381 (= E365)
- binding glycerol: E171 (= E167), Y310 (= Y298), E381 (= E365), W428 (= W416), E435 (≠ S423), F444 (≠ Y432)
- binding zinc ion: D60 (= D55), H63 (= H58)
3wh8A Crystal structure of gh1 beta-glucosidase td2f2 isofagomine complex (see paper)
33% identity, 96% coverage: 5:453/466 of query aligns to 1:430/437 of 3wh8A
- binding 5-hydroxymethyl-3,4-dihydroxypiperidine: Q16 (= Q20), H117 (= H121), E162 (= E167), Y289 (= Y298), R319 (≠ N338), E346 (= E365), W393 (= W416), E400 (≠ S423), W401 (= W424), Y409 (= Y432)
4hz7A Crystal structure of bglb with glucose (see paper)
32% identity, 98% coverage: 5:462/466 of query aligns to 2:440/441 of 4hz7A
- active site: R74 (= R76), H118 (= H121), E163 (= E167), V166 (= V170), N290 (= N296), Y292 (= Y298), E347 (= E365)
- binding beta-D-glucopyranose: Q17 (= Q20), H118 (= H121), E163 (= E167), Y292 (= Y298), E347 (= E365), W394 (= W416), E401 (≠ S423), W402 (= W424), F410 (≠ Y432)
3ahvA Semi-active e176q mutant of rice bglu1 covalent complex with 2-deoxy- 2-fluoroglucoside (see paper)
32% identity, 98% coverage: 1:456/466 of query aligns to 6:469/472 of 3ahvA
- active site: R82 (= R76), H126 (= H121), Q172 (≠ E167), I175 (≠ V170), N309 (= N296), Y311 (= Y298), E382 (= E365)
- binding 2-deoxy-2-fluoro-alpha-D-glucopyranose: Q25 (= Q20), H126 (= H121), N171 (= N166), Y311 (= Y298), E382 (= E365), W429 (= W416), E436 (≠ S423), F445 (≠ Y432)
- binding zinc ion: D61 (= D55), H64 (= H58)
3ahtA Crystal structure of rice bglu1 e176q mutant in complex with laminaribiose (see paper)
32% identity, 98% coverage: 1:456/466 of query aligns to 5:468/471 of 3ahtA
- active site: R81 (= R76), H125 (= H121), Q171 (≠ E167), I174 (≠ V170), N308 (= N296), Y310 (= Y298), E381 (= E365)
- binding beta-D-glucopyranose: Q24 (= Q20), H125 (= H121), Q171 (≠ E167), Q171 (≠ E167), Y310 (= Y298), Y310 (= Y298), W353 (vs. gap), W353 (vs. gap), E381 (= E365), W428 (= W416), E435 (≠ S423), F444 (≠ Y432)
- binding zinc ion: D60 (= D55), H63 (= H58)
3scoA Crystal structure of rice bglu1 e386g mutant complexed with alpha- glucosyl fluoride
32% identity, 98% coverage: 1:456/466 of query aligns to 6:469/472 of 3scoA
- active site: R82 (= R76), H126 (= H121), E172 (= E167), I175 (≠ V170), N309 (= N296), Y311 (= Y298), G382 (≠ E365)
- binding alpha-D-glucopyranosyl fluoride: Q25 (= Q20), H126 (= H121), N171 (= N166), E172 (= E167), Y311 (= Y298), W429 (= W416), E436 (≠ S423), F445 (≠ Y432)
- binding zinc ion: D61 (= D55), H64 (= H58)
7wdsA Crystal structures of mebgld2 in complex with various saccharides
34% identity, 98% coverage: 4:462/466 of query aligns to 3:444/444 of 7wdsA
- binding beta-D-xylopyranose: Q19 (= Q20), H120 (= H121), E165 (= E167), L172 (≠ G174), Y294 (= Y298), W324 (≠ N338), E351 (= E365), W398 (= W416), E405 (≠ S423), W406 (= W424), R408 (≠ N426)
7wdnA Crystal structures of mebgld2 in complex with various saccharides (see paper)
34% identity, 98% coverage: 4:462/466 of query aligns to 3:444/444 of 7wdnA
- binding alpha-D-glucopyranose: Q19 (= Q20), E25 (≠ N26), D35 (= D34), H120 (= H121), E165 (= E167), E165 (= E167), K186 (≠ G188), N222 (= N223), F246 (= F247), W266 (≠ I267), Y267 (≠ L268), Y294 (= Y298), P306 (≠ Y310), M307 (≠ T311), W324 (≠ N338), E351 (= E365), W398 (= W416), E405 (≠ S423), W406 (= W424), F414 (≠ Y432)
7wdoA Crystal structures of mebgld2 in complex with various saccharides
34% identity, 98% coverage: 4:462/466 of query aligns to 3:444/445 of 7wdoA
- binding beta-D-glucopyranose: Q19 (= Q20), H120 (= H121), W121 (≠ F122), N164 (= N166), E165 (= E167), E165 (= E167), N222 (= N223), N224 (≠ T225), Y294 (= Y298), E351 (= E365), W398 (= W416), E405 (≠ S423), W406 (= W424), F414 (≠ Y432)
Query Sequence
>BWI76_RS22380 FitnessBrowser__Koxy:BWI76_RS22380
MTRYQFPEGFFWGAAASGPQTEGISNKPHRSIWDSWFAEQPERFYQQIGPQTVCDTYHQY
PQDVALMKRTGFNSFRTSIQWSRLIDDFETGAPNPDAVRFYHAYLDEMIENGIEPMINLY
HFDMPEALQKQYGGFESAHVTDLFARFARTAFELFGHKVKYWITFNEPIVPVEGGYLYDF
HYPCKKDGRLAAQVAFNIMLAHAKAVREFRTLALESEIGVVLNLTPSYTRNDSAEDKKAA
WYADLFFNRSFLDPLVKHQFPKELCEILAAHDCLPEVTKADVELISGSRVDFLGVNYYVP
RRVKARESDYTLDYFTPEFYFENYVNPEGRFNPYRDNNEILPQAIYDIAANIRDNYGNKK
WFLAEIGIAMDIDSEGEPGEDGVIDDSFRIGLMEEHLVQLHRAIADGANCFGVHQWTFID
NWSWINSFKRRYGFWRLNLQTGERQIKRNALWFAELATSNGFSSDK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory