SitesBLAST
Comparing BWI76_RS22830 FitnessBrowser__Koxy:BWI76_RS22830 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3n6hB Crystal structure of mandelate racemase/muconate lactonizing protein from actinobacillus succinogenes 130z complexed with magnesium/sulfate
71% identity, 99% coverage: 4:445/446 of query aligns to 1:430/432 of 3n6hB
- active site: K189 (= K204), K191 (= K206), D219 (= D234), N221 (= N236), E244 (= E259), N273 (= N288), D297 (= D312), H323 (= H338), N325 (= N340)
- binding magnesium ion: D219 (= D234), E244 (= E259), N273 (= N288)
3pfrA Crystal structure of d-glucarate dehydratase related protein from actinobacillus succinogenes complexed with d-glucarate
71% identity, 99% coverage: 5:445/446 of query aligns to 1:426/426 of 3pfrA
- active site: K185 (= K204), K187 (= K206), D215 (= D234), N217 (= N236), E240 (= E259), N269 (= N288), D293 (= D312), H319 (= H338), N321 (= N340)
- binding d-glucarate: N22 (= N26), H27 (= H31), Y130 (= Y149), F132 (= F151), K187 (= K206), D215 (= D234), N217 (= N236), N269 (= N288), H319 (= H338), S320 (= S339), N321 (= N340), H348 (= H367)
- binding magnesium ion: D215 (= D234), E240 (= E259), N269 (= N288)
P0AES2 Glucarate dehydratase; GDH; GlucD; D-glucarate dehydratase; EC 4.2.1.40 from Escherichia coli (strain K12) (see 3 papers)
64% identity, 100% coverage: 1:445/446 of query aligns to 1:446/446 of P0AES2
- M1 (= M1) modified: Initiator methionine, Removed
- Y150 (= Y149) mutation to F: Reduces activity 100-fold.
- K207 (= K206) active site, Proton acceptor; mutation to Q: Reduces activity 1000-fold.; mutation to R: Reduces activity 10000-fold.
- D235 (= D234) binding
- E266 (= E265) binding
- N289 (= N288) binding
- H339 (= H338) active site, Proton acceptor; mutation to A: Loss of activity.; mutation to N: Reduces activity 10000-fold.; mutation to Q: Reduces activity 1000-fold.
- N341 (= N340) mutation to D: Inactive in the dehydration reaction of D-glucarate, L-idarate, and 4F-Gluc.; mutation to L: Almost no effect on the dehydration reaction of D-glucarate, L-idarate, and 4F-Gluc.
- D366 (= D365) mutation D->A,N: Reduces activity over 100-fold.
1ecqA E. Coli glucarate dehydratase bound to 4-deoxyglucarate (see paper)
64% identity, 99% coverage: 5:445/446 of query aligns to 4:444/444 of 1ecqA
- active site: K203 (= K204), K205 (= K206), D233 (= D234), N235 (= N236), E258 (= E259), N287 (= N288), M288 (= M289), D311 (= D312), H337 (= H338), N339 (= N340), I363 (= I364)
- binding 4-deoxyglucarate: N25 (= N26), H30 (= H31), T101 (= T104), Y148 (= Y149), F150 (= F151), K205 (= K206), D233 (= D234), N235 (= N236), N287 (= N288), H337 (= H338), S338 (= S339), N339 (= N340), H366 (= H367), R420 (= R421)
- binding magnesium ion: D233 (= D234), E258 (= E259), N287 (= N288)
1ec9D E. Coli glucarate dehydratase bound to xylarohydroxamate (see paper)
64% identity, 99% coverage: 5:445/446 of query aligns to 4:444/444 of 1ec9D
- active site: K203 (= K204), K205 (= K206), D233 (= D234), N235 (= N236), E258 (= E259), N287 (= N288), M288 (= M289), D311 (= D312), H337 (= H338), N339 (= N340), I363 (= I364)
- binding magnesium ion: D233 (= D234), E258 (= E259), N287 (= N288)
- binding xylarohydroxamate: H30 (= H31), T101 (= T104), Y148 (= Y149), F150 (= F151), K205 (= K206), D233 (= D234), N235 (= N236), N287 (= N288), H337 (= H338), S338 (= S339), N339 (= N340), H366 (= H367), R420 (= R421)
1ec8A E. Coli glucarate dehydratase bound to product 2,3-dihydroxy-5-oxo- hexanedioate (see paper)
64% identity, 99% coverage: 5:445/446 of query aligns to 2:442/442 of 1ec8A
- active site: K201 (= K204), K203 (= K206), D231 (= D234), N233 (= N236), E256 (= E259), N285 (= N288), M286 (= M289), D309 (= D312), H335 (= H338), N337 (= N340), I361 (= I364)
- binding 2,3-dihydroxy-5-oxo-hexanedioate: N23 (= N26), H28 (= H31), T99 (= T104), Y146 (= Y149), K203 (= K206), D231 (= D234), N233 (= N236), N285 (= N288), H335 (= H338), S336 (= S339), N337 (= N340), H364 (= H367), R418 (= R421)
- binding magnesium ion: D231 (= D234), E256 (= E259), N285 (= N288)
1jctA Glucarate dehydratase, n341l mutant orthorhombic form (see paper)
64% identity, 99% coverage: 5:445/446 of query aligns to 3:443/443 of 1jctA
- active site: K202 (= K204), K204 (= K206), D232 (= D234), N234 (= N236), E257 (= E259), N286 (= N288), M287 (= M289), D310 (= D312), H336 (= H338), L338 (≠ N340), I362 (= I364)
- binding d-glucarate: N24 (= N26), H29 (= H31), T100 (= T104), Y147 (= Y149), F149 (= F151), K204 (= K206), D232 (= D234), N286 (= N288), S337 (= S339), R419 (= R421)
- binding magnesium ion: D232 (= D234), E257 (= E259), N286 (= N288)
3p0wB Crystal structure of d-glucarate dehydratase from ralstonia solanacearum complexed with mg and d-glucarate
64% identity, 98% coverage: 6:441/446 of query aligns to 2:426/428 of 3p0wB
- active site: K189 (= K204), K191 (= K206), D219 (= D234), N221 (= N236), E244 (= E259), N273 (= N288), D297 (= D312), H323 (= H338), N325 (= N340)
- binding d-glucarate: H27 (= H31), Y134 (= Y149), K191 (= K206), D219 (= D234), N221 (= N236), N273 (= N288), H323 (= H338), N325 (= N340), H352 (= H367), R406 (= R421)
- binding magnesium ion: D219 (= D234), E244 (= E259), N273 (= N288)
3nxlC Crystal structure of glucarate dehydratase from burkholderia cepacia complexed with magnesium
62% identity, 98% coverage: 6:444/446 of query aligns to 2:425/425 of 3nxlC
3nfuA Crystal structure of probable glucarate dehydratase from chromohalobacter salexigens dsm 3043 complexed with magnesium
56% identity, 98% coverage: 7:443/446 of query aligns to 3:439/441 of 3nfuA
- active site: K201 (= K204), K203 (= K206), D231 (= D234), N233 (= N236), E256 (= E259), N285 (= N288), D309 (= D312), H335 (= H338), N337 (= N340)
- binding magnesium ion: D231 (= D234), N233 (= N236), E256 (= E259), D257 (= D260), N285 (= N288)
4it1D Crystal structure of enolase pfl01_3283 (target efi-502286) from pseudomonas fluorescens pf0-1 with bound magnesium, potassium and tartrate
37% identity, 97% coverage: 9:440/446 of query aligns to 6:426/427 of 4it1D
- active site: S51 (≠ A54), D54 (≠ G57), A98 (vs. gap), Y150 (= Y149), K194 (= K204), K196 (= K206), D224 (= D234), N226 (= N236), Y247 (= Y257), E249 (= E259), T271 (= T287), N272 (= N288), M273 (= M289), D296 (= D312), H323 (= H338), S324 (= S339), N325 (= N340), C349 (≠ I364), D350 (= D365)
- binding magnesium ion: D224 (= D234), E249 (= E259), N272 (= N288)
3vc6A Crystal structure of enolase tbis_1083(target efi-502310) from thermobispora bispora dsm 43833 complexed with magnesium and formate
35% identity, 97% coverage: 6:438/446 of query aligns to 1:417/420 of 3vc6A
- active site: D52 (≠ G57), H55 (≠ I60), Y146 (= Y149), K188 (= K204), K190 (= K206), D218 (= D234), N220 (= N236), E243 (= E259), N266 (= N288), M267 (= M289), D290 (= D312), H317 (= H338), S318 (= S339), N319 (= N340), H321 (= H342), C343 (≠ I364), D344 (= D365)
- binding magnesium ion: D218 (= D234), E243 (= E259), N266 (= N288)
3va8A Crystal structure of enolase fg03645.1 (target efi-502278) from gibberella zeae ph-1 complexed with magnesium, formate and sulfate
33% identity, 97% coverage: 8:441/446 of query aligns to 12:425/427 of 3va8A
3ozmD Crystal structure of enolase superfamily member from bordetella bronchiseptica complexed with mg, m-xylarate and l-lyxarate
26% identity, 83% coverage: 39:406/446 of query aligns to 37:369/381 of 3ozmD
- active site: G53 (= G56), D56 (vs. gap), S143 (≠ D160), K170 (= K204), K172 (= K206), D200 (= D234), N202 (= N236), E226 (= E259), G252 (≠ N288), E253 (≠ M289), N254 (≠ I290), Q274 (≠ L310), D276 (= D312), H303 (= H338), T304 (≠ S339), F305 (≠ N340), E328 (≠ D365), I331 (≠ W368), H333 (≠ W370)
- binding L-arabinaric acid: K172 (= K206), D200 (= D234), N202 (= N236), E253 (≠ M289), H303 (= H338), F305 (≠ N340), E328 (≠ D365)
- binding magnesium ion: D200 (= D234), E226 (= E259), E253 (≠ M289)
Sites not aligning to the query:
3ozmA Crystal structure of enolase superfamily member from bordetella bronchiseptica complexed with mg, m-xylarate and l-lyxarate
26% identity, 83% coverage: 39:406/446 of query aligns to 37:369/386 of 3ozmA
- active site: G53 (= G56), D56 (vs. gap), S143 (≠ D160), K170 (= K204), K172 (= K206), D200 (= D234), N202 (= N236), E226 (= E259), G252 (≠ N288), E253 (≠ M289), N254 (≠ I290), Q274 (≠ L310), D276 (= D312), H303 (= H338), T304 (≠ S339), F305 (≠ N340), E328 (≠ D365), I331 (≠ W368), H333 (≠ W370)
- binding D-xylaric acid: Y146 (= Y163), K170 (= K204), K172 (= K206), D200 (= D234), N202 (= N236), E253 (≠ M289), H303 (= H338), F305 (≠ N340), E328 (≠ D365)
- binding magnesium ion: D200 (= D234), E226 (= E259), E253 (≠ M289)
Sites not aligning to the query:
3op2A Crystal structure of putative mandelate racemase from bordetella bronchiseptica rb50 complexed with 2-oxoglutarate/phosphate
26% identity, 83% coverage: 39:406/446 of query aligns to 37:364/375 of 3op2A
- active site: G53 (= G56), D56 (vs. gap), S138 (≠ D160), K165 (= K204), K167 (= K206), D195 (= D234), N197 (= N236), E221 (= E259), G247 (≠ N288), E248 (≠ M289), N249 (≠ I290), Q269 (≠ L310), D271 (= D312), H298 (= H338), T299 (≠ S339), F300 (≠ N340), E323 (≠ D365), I326 (≠ W368), H328 (≠ W370)
- binding 2-oxoglutaric acid: K165 (= K204), K167 (= K206), D195 (= D234), E248 (≠ M289), H298 (= H338), E323 (≠ D365)
- binding magnesium ion: D195 (= D234), E221 (= E259), E248 (≠ M289)
Sites not aligning to the query:
3ugvF Crystal structure of an enolase from alpha pretobacterium bal199 (efi target efi-501650) with bound mg
27% identity, 67% coverage: 107:405/446 of query aligns to 97:355/364 of 3ugvF
- active site: S137 (vs. gap), K168 (= K204), R170 (≠ K206), D199 (= D234), N201 (= N236), E225 (= E259), G250 (≠ A291), E251 (≠ T292), N252 (= N293), M272 (≠ L310), D274 (= D312), A293 (≠ D330), H301 (= H338), L302 (≠ M349), Y303 (≠ F350), E321 (vs. gap)
- binding magnesium ion: D199 (= D234), E225 (= E259), R240 (= R278), L243 (≠ T281), E251 (≠ T292)
Sites not aligning to the query:
3dg6A Crystal structure of muconate lactonizing enzyme from mucobacterium smegmatis complexed with muconolactone (see paper)
25% identity, 67% coverage: 110:406/446 of query aligns to 97:360/366 of 3dg6A
- active site: M134 (≠ A181), K160 (= K204), K162 (= K206), D191 (= D234), N193 (= N236), E217 (= E259), D242 (≠ N288), E243 (≠ M289), S244 (≠ I290), K266 (≠ P309), G292 (≠ H338), N293 (≠ S339), Q294 (≠ N340), G319 (≠ D365), E320 (≠ T366), L321 (≠ H367)
- binding magnesium ion: D191 (= D234), E217 (= E259), D242 (≠ N288)
- binding [(2S)-5-oxo-2,5-dihydrofuran-2-yl]acetic acid: M134 (≠ A181), K160 (= K204), K162 (= K206), D191 (= D234), N193 (= N236), D242 (≠ N288), K266 (≠ P309), N293 (≠ S339), Q294 (≠ N340), I295 (≠ N341)
Sites not aligning to the query:
3t8qB Crystal structure of mandelate racemase/muconate lactonizing enzyme family protein from hoeflea phototrophica
28% identity, 65% coverage: 110:401/446 of query aligns to 82:353/369 of 3t8qB
- active site: S120 (≠ R156), K147 (= K204), R149 (≠ K206), D159 (≠ I216), D185 (= D242), N187 (vs. gap), E211 (= E259), G236 (vs. gap), E237 (vs. gap), D239 (≠ N288), Q258 (≠ L310), D260 (= D312), H287 (= H338), A288 (≠ S339), A289 (≠ N340), K310 (≠ T362), E313 (vs. gap)
- binding magnesium ion: D185 (= D242), E211 (= E259), E237 (vs. gap)
2ps2A Crystal structure of putative mandelate racemase/muconate lactonizing enzyme from aspergillus oryzae
23% identity, 87% coverage: 28:413/446 of query aligns to 18:361/361 of 2ps2A
- active site: Y21 (≠ H31), S132 (= S166), Q156 (≠ K201), S157 (≠ D202), V158 (≠ F203), K159 (= K204), D187 (= D234), E213 (= E259), D236 (≠ N288), E237 (≠ M289), K260 (≠ A311), Q287 (≠ H338), E288 (≠ S339), T289 (≠ N340), C313 (≠ W368), I314 (= I369), L315 (≠ W370)
- binding magnesium ion: D187 (= D234), E213 (= E259), D236 (≠ N288)
Query Sequence
>BWI76_RS22830 FitnessBrowser__Koxy:BWI76_RS22830
MTTQSSPVITDMKVIPVAGQDSMLLNIGGAHNAYFTRNIVVLTDSAGNTGVGEAPGGEVI
YQTLVDAIPMVLGQEIARLNKVVQQVHKGNQAADFDTFGKGAWTFELRVNAVAALEAALL
DLLGKALNVPVCELLGPGKQRDAVTVLGYLFYVGDRTKTDLPYLESTPGSHAWYRLRHQQ
ALNSEAVVRLAEAAQDRYGFKDFKLKGGVLPGEQEIETARALKKRFPDARITVDPNGAWL
LDEAIALCKGLNDVLTYAEDPCGAEQGFSGREVMAEFRRATGLPVATNMIATNWREMGHA
VMLNAVDIPLADPHFWTLSGAVRVAQLCDDWGLTWGCHSNNHFDISLAMFTHVGAAAPGN
PTAIDTHWIWQEGDCRLTKNPLEIKHGKIAVPDAPGLGVELDWEQVQKAHEAYTRLPGGA
RNDAGPMQYLIPGWTFDRKRPVFGRH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory