Comparing BWI76_RS22885 FitnessBrowser__Koxy:BWI76_RS22885 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
6st0A Taurine abc transporter substrate binding protein taua from e. Coli in complex with n-(2-acetamido)-2-aminoethanesulfonic acid (see paper)
29% identity, 58% coverage: 48:227/313 of query aligns to 21:201/298 of 6st0A
Sites not aligning to the query:
6ssyA Taurine abc transporter substrate binding protein taua from e. Coli in complex with 2-aminoethylphosphonic acid (see paper)
29% identity, 58% coverage: 48:227/313 of query aligns to 21:201/298 of 6ssyA
Sites not aligning to the query:
>BWI76_RS22885 FitnessBrowser__Koxy:BWI76_RS22885
MLRLSRPALLLLLAGLSTSALAKAPETVNIGYQKANIFALLKYRGTLDESFKKQGIAVRW
IEFPAGPQMLEGLNVGSIDLAATGDAPPAFAQAAQADLVYLAHSPANPKTEAIVVAENSA
IKSVADLKGKRVGLNKGSDVNYLLVTALEKAGLSYKDITPVYLPPADARAAFQRGAIDAW
VIWDPFLAEVETNAKARQIRNAEGLVPHYTFYLASRKFADTYPDTAKQVVDELGKLSEWA
NGHQDDAAGILSTSTGLDKAIWLKTLARLPYGAERMTPAVYNEQQALADTFTRIGLLPVK
VDVRSATWSLDKQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory