Comparing BWI76_RS23015 FitnessBrowser__Koxy:BWI76_RS23015 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5x40A Structure of a cbio dimer bound with amppcp (see paper)
38% identity, 85% coverage: 32:262/271 of query aligns to 36:274/280 of 5x40A
Sites not aligning to the query:
Q5M244 Energy-coupling factor transporter ATP-binding protein EcfA2; ECF transporter A component EcfA2; EC 3.6.3.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
34% identity, 84% coverage: 20:247/271 of query aligns to 26:256/280 of Q5M244
Q5M243 Energy-coupling factor transporter ATP-binding protein EcfA1; ECF transporter A component EcfA1; EC 7.-.-.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
33% identity, 97% coverage: 1:262/271 of query aligns to 1:269/276 of Q5M243
5d3mA Folate ecf transporter: amppnp bound state (see paper)
34% identity, 88% coverage: 9:247/271 of query aligns to 13:254/280 of 5d3mA
8bmpA Cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs bound to atp and adp (see paper)
34% identity, 86% coverage: 15:247/271 of query aligns to 18:251/278 of 8bmpA
Sites not aligning to the query:
8bmsA Cryo-em structure of the mutant solitary ecf module 2eq in msp2n2 lipid nanodiscs in the atpase closed and atp-bound conformation (see paper)
33% identity, 88% coverage: 9:247/271 of query aligns to 12:251/278 of 8bmsA
8bmpB Cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs bound to atp and adp (see paper)
34% identity, 85% coverage: 17:247/271 of query aligns to 22:255/281 of 8bmpB
Sites not aligning to the query:
5d3mB Folate ecf transporter: amppnp bound state (see paper)
34% identity, 85% coverage: 17:247/271 of query aligns to 22:255/281 of 5d3mB
Sites not aligning to the query:
8bmsB Cryo-em structure of the mutant solitary ecf module 2eq in msp2n2 lipid nanodiscs in the atpase closed and atp-bound conformation (see paper)
34% identity, 85% coverage: 17:247/271 of query aligns to 22:255/281 of 8bmsB
Sites not aligning to the query:
4hluC Structure of the ecfa-a' heterodimer bound to adp (see paper)
34% identity, 73% coverage: 9:205/271 of query aligns to 12:208/249 of 4hluC
4zirB Crystal structure of ecfaa' heterodimer bound to amppnp (see paper)
34% identity, 73% coverage: 9:205/271 of query aligns to 11:204/247 of 4zirB
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
31% identity, 84% coverage: 1:228/271 of query aligns to 1:228/240 of 4ymuJ
7chaI Cryo-em structure of p.Aeruginosa mlafebd with amppnp (see paper)
33% identity, 79% coverage: 7:220/271 of query aligns to 9:224/262 of 7chaI
4hluA Structure of the ecfa-a' heterodimer bound to adp (see paper)
31% identity, 75% coverage: 17:218/271 of query aligns to 23:220/265 of 4hluA
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 77% coverage: 17:225/271 of query aligns to 21:230/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
33% identity, 77% coverage: 17:225/271 of query aligns to 22:231/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
33% identity, 77% coverage: 17:225/271 of query aligns to 22:231/344 of 3tuiC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
33% identity, 77% coverage: 17:225/271 of query aligns to 22:231/344 of 6cvlD
Sites not aligning to the query:
4zirA Crystal structure of ecfaa' heterodimer bound to amppnp (see paper)
31% identity, 75% coverage: 17:218/271 of query aligns to 23:218/263 of 4zirA
Sites not aligning to the query:
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
31% identity, 82% coverage: 2:224/271 of query aligns to 12:236/265 of P07821
>BWI76_RS23015 FitnessBrowser__Koxy:BWI76_RS23015
MLATTDLWFRYQDEPVLKGLTLDFSHHAVTGLVGANGCGKSTLFMNLSGLLRPQSGAVQW
QGKPLDYSKRGLLALRQQVATVFQDPDQQIFYTDIDSDIAFSLRNLGVAEEEIARRVDDA
LTLVDAQGFRHQPIQCLSHGQKKRVAIAGALVLQARYLLLDEPTAGLDPSGRAQMIDIIK
RIADRGNHVAISSHDIDLIYEVSDAVYVLRRGEVLAHGEPGEVFARSELMAQAGLTQPWL
VKLHAQLGLPLCKTEEEFFTRMRSNAMKEAS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory