SitesBLAST
Comparing BWI76_RS23100 FitnessBrowser__Koxy:BWI76_RS23100 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
B1VB61 Propanediol uptake facilitator PduF from Citrobacter freundii (see paper)
88% identity, 100% coverage: 1:266/266 of query aligns to 1:266/269 of B1VB61
P37451 Propanediol uptake facilitator PduF from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
87% identity, 99% coverage: 1:264/266 of query aligns to 1:264/264 of P37451
P0AER0 Glycerol uptake facilitator protein; Aquaglyceroporin; Glycerol facilitator from Escherichia coli (strain K12) (see 3 papers)
68% identity, 100% coverage: 1:266/266 of query aligns to 3:268/281 of P0AER0
- HLN 66:68 (= HLN 64:66) binding
- Y138 (= Y136) binding
- GFA 199:201 (= GFA 197:199) binding
- N203 (= N201) binding
- R206 (= R204) binding
- PL 236:237 (≠ PI 234:235) mutation to FW: No detectable water or glycerol permeability.
1fx8A Crystal structure of the e. Coli glycerol facilitator (glpf) with substrate glycerol (see paper)
69% identity, 95% coverage: 4:257/266 of query aligns to 1:254/254 of 1fx8A
O14520 Aquaporin-7; AQP-7; Aquaglyceroporin-7; Aquaporin adipose; AQPap; Aquaporin-7-like from Homo sapiens (Human) (see 4 papers)
35% identity, 100% coverage: 1:266/266 of query aligns to 29:289/342 of O14520
- V59 (vs. gap) to L: in dbSNP:rs4008659
- Y135 (≠ S107) Important for permeability to glycerol; mutation to A: Strongly decreased permeability to glycerol. Mildly decreased water permeability.
- H165 (≠ S140) mutation to A: Decreased permeability to glycerol. Mildly decreased water permeability.
- G264 (= G241) to V: affects water and glycerol transport; dbSNP:rs62542743
Sites not aligning to the query:
- 1:32 mutation Missing: Decreased interaction with PLIN1.
- 12 R → C: in dbSNP:rs139297434
Q96PS8 Aquaporin-10; AQP-10; Aquaglyceroporin-10; Small intestine aquaporin from Homo sapiens (Human) (see 2 papers)
36% identity, 98% coverage: 5:266/266 of query aligns to 20:277/301 of Q96PS8
- E27 (= E12) mutation to Q: Abolishes permeability to glycerol.
- G73 (≠ T57) mutation to A: Increased permeability to glycerol at acidic pH.; mutation to F: Abolishes permeability to glycerol.
- S77 (= S61) mutation S->A,D: Nearly abolishes permeability to glycerol.
- H80 (= H64) mutation to A: Abolishes permeability to glycerol.
- F85 (≠ V69) mutation to A: Nearly abolishes permeability to glycerol.
- R94 (≠ C78) mutation to A: Abolishes permeability to glycerol.
- N133 (≠ H117) modified: carbohydrate, N-linked (GlcNAc...) asparagine; mutation to Q: Abolishes N-glycosylation.
6f7hC Crystal structure of human aqp10 (see paper)
37% identity, 94% coverage: 5:253/266 of query aligns to 5:249/253 of 6f7hC
8c9hA Aqp7_inhibitor
34% identity, 96% coverage: 1:255/266 of query aligns to 4:253/253 of 8c9hA
6n1gA Crystal structure of aquaglyceroporin aqp7 (see paper)
35% identity, 95% coverage: 4:257/266 of query aligns to 1:249/249 of 6n1gA
I1CR68 Aquaporin-1 from Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) (Mucormycosis agent) (Rhizopus arrhizus var. delemar) (see paper)
35% identity, 88% coverage: 11:245/266 of query aligns to 63:292/306 of I1CR68
- H275 (≠ G225) mutation to A: Affects pH sensing; when associated with A-85.
2evuA Crystal structure of aquaporin aqpm at 2.3a resolution (see paper)
36% identity, 94% coverage: 4:252/266 of query aligns to 3:243/245 of 2evuA
3c02A X-ray structure of the aquaglyceroporin from plasmodium falciparum (see paper)
31% identity, 94% coverage: 4:253/266 of query aligns to 1:235/242 of 3c02A
O94778 Aquaporin-8; AQP-8 from Homo sapiens (Human) (see 4 papers)
36% identity, 75% coverage: 9:208/266 of query aligns to 38:217/261 of O94778
- C38 (= C9) mutation to S: Does not affect loss of hydrogen peroxide transport after stress.
- F48 (= F19) mutation to A: Loss of hydrogen peroxide transport activity under stress condition.
- C53 (= C26) modified: Cysteine persulfide; modified: Cysteine sulfenic acid (-SOH); mutation to S: Does not affect hydrogen peroxide transport under stress condition.
- H72 (≠ W46) mutation to A: Does not affect hydrogen peroxide transport activity under stress condition.
- C173 (≠ I161) mutation to A: Loss of hydrogen peroxide transporter activity.; mutation to S: Slightly affect hydrogen peroxide transport after stress.
- C208 (≠ A199) mutation to S: Does not affect loss of hydrogen peroxide transport after stress.
- R213 (= R204) mutation to A: Does not affect hydrogen peroxide transport activity under stress condition.
Sites not aligning to the query:
- 8 C→S: Does not affect loss of hydrogen peroxide transport after stress.
- 229 I → M: in a breast cancer sample; somatic mutation
- 247 C→S: Does not affect loss of hydrogen peroxide transport after stress.
3nkaA Crystal structure of aqpz h174g,t183f (see paper)
32% identity, 82% coverage: 1:217/266 of query aligns to 3:202/230 of 3nkaA
P55064 Aquaporin-5; AQP-5 from Homo sapiens (Human) (see 2 papers)
33% identity, 92% coverage: 11:256/266 of query aligns to 16:228/265 of P55064
- A38 (= A35) to E: in PPKB; retains the ability to traffic to the cell membrane; dbSNP:rs398123054
- I45 (= I42) to S: in PPKB; retains the ability to traffic to the cell membrane; dbSNP:rs398123055
- N123 (≠ A130) to D: in PPKB; retains the ability to traffic to the cell membrane; dbSNP:rs398123057
- S156 (≠ V171) mutation to A: No effect on location at the cell membrane.; mutation to E: Increased location at the cell membrane.
- I177 (≠ G193) to F: in PPKB; retains the ability to traffic to the cell membrane; dbSNP:rs398123056
- R188 (= R204) to C: in PPKB; retains the ability to traffic to the cell membrane; dbSNP:rs368292687
5dyeD Crystal structure of the full length s156e mutant of human aquaporin 5 (see paper)
33% identity, 92% coverage: 11:256/266 of query aligns to 15:227/253 of 5dyeD
P41181 Aquaporin-2; AQP-2; ADH water channel; Aquaporin-CD; AQP-CD; Collecting duct water channel protein; WCH-CD; Water channel protein for renal collecting duct from Homo sapiens (Human) (see 12 papers)
35% identity, 91% coverage: 11:253/266 of query aligns to 15:223/271 of P41181
- G64 (= G62) to R: in NDI2; loss of water channel activity; dbSNP:rs104894326
- G78 (≠ A77) mutation to A: Does not affect interaction with MIAC; when associated with A-79.
- C79 (= C78) mutation to A: Does not affect interaction with MIAC; when associated with A-78.
- S148 (≠ L164) mutation to A: No effect on sorting from the ER to the vesicles, redistribution to apical membrane, or endocytosis.; mutation to D: Retained in the endoplasmic reticulum.
- R187 (= R204) to C: in NDI2; loss of water channel activity; mutant protein does not fold properly; dbSNP:rs104894328
- A190 (≠ G207) to T: in NDI2; mutant protein does not fold properly and is not functional; dbSNP:rs104894341
- V194 (≠ M222) to I: in dbSNP:rs772051028
- S216 (≠ A246) to P: in NDI2; loss of water channel activity; dbSNP:rs104894329
- L217 (≠ A247) mutation to A: Abolishes interaction with MIAC; when associated with A-221.
- Y221 (= Y251) mutation to A: Abolishes interaction with MIAC; when associated with A-217.
Sites not aligning to the query:
- 229 S→A: No effect on sorting from the ER to the vesicles, redistribution to apical membrane, or endocytosis.; S→D: No effect on sorting from the ER to the vesicles, redistribution to apical membrane, or endocytosis.
- 231 S→A: No effect on sorting from the ER to the vesicles, redistribution to apical membrane, or endocytosis.; S→D: No effect on sorting from the ER to the vesicles, redistribution to apical membrane, or endocytosis.
- 232 E→A: Reduces interaction with MIAC.
- 244 T→A: No effect on sorting from the ER to the vesicles, redistribution to apical membrane, or endocytosis.; T→E: No effect on sorting from the ER to the vesicles, redistribution to apical membrane, or endocytosis.
- 254 R → L: in NDI2; results in the loss of arginine vasopressin-mediated phosphorylation at S-256; R → Q: in NDI2; exerts a dominant-negative effect on wild-type-AQP2 in that it interferes with its trafficking to the apical membrane; is a loss of function instead of a gain of function mutation on dominant nephrogenic diabetes insipidus
- 256 modified: Phosphoserine; by PKA; S→A: Retained in vesicles.; S→D: Expressed in the apical membrane.
- 258 E → K: in NDI2; retained in the Golgi compartment; dbSNP:rs104894332
- 262 P → L: in NDI2; mutant protein folds properly and is functional but is retained in intracellular vesicles; able to assemble into tetramers with wild-type AQP2 that properly localize to the apical membrane; dbSNP:rs104894339; P→A: No effect on expression at the apical cell membrane.
4nefA X-ray structure of human aquaporin 2 (see paper)
35% identity, 91% coverage: 11:253/266 of query aligns to 14:222/239 of 4nefA
P60844 Aquaporin Z; Bacterial nodulin-like intrinsic protein; Water channel AqpZ from Escherichia coli (strain K12) (see paper)
31% identity, 82% coverage: 1:217/266 of query aligns to 1:200/231 of P60844
- C9 (= C9) mutation to S: No effect.
- C20 (= C26) mutation to S: Loss of oligomerization; no alteration of water permeability.
- T183 (≠ F198) mutation to C: No effect.
- R189 (= R204) mutation R->V,S: Loss of function.
P56402 Aquaporin-2; AQP-2; ADH water channel; Aquaporin-CD; AQP-CD; Collecting duct water channel protein; WCH-CD; Water channel protein for renal collecting duct from Mus musculus (Mouse) (see 2 papers)
34% identity, 91% coverage: 11:253/266 of query aligns to 15:223/271 of P56402
- T126 (≠ P137) mutation to M: Does not cause loss of water channel activity, but impairs trafficking from cytoplasmic vesicles to the cell membrane.
Sites not aligning to the query:
- 256 modified: Phosphoserine; S → L: in cph; loss of a phosphorylation site and loss of trafficking to the apical cell membrane; causes aberrant location at the basolateral cell membrane
Query Sequence
>BWI76_RS23100 FitnessBrowser__Koxy:BWI76_RS23100
MNDSLKAQCTAEFLGTGLFLFFGIGCLSALKVAGASLGLWEICIIWGLGISLAVYLTSGI
SGGHLNPAVTVALWLFACFPGRKVFPYIVSQVAGAFGGAVLAYVLYSTMFTEFESAHHIA
RGSVESLQLASIFSTYPAASLSIWHAALVEVVITSMLMGMIMALTDDGNGVPKGPLAPLL
IGLLVAVIGASTGPLTGFAMNPARDFGPKLFTWMAGWGDIAMTGGRDIPYFIVPIIAPLI
GACLGAAIYRYLIGNNLPCNTCKLED
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory