SitesBLAST
Comparing BWI76_RS23345 FitnessBrowser__Koxy:BWI76_RS23345 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5fooA 6-phospho-beta-glucosidase (see paper)
41% identity, 97% coverage: 6:466/475 of query aligns to 2:462/463 of 5fooA
- active site: R74 (= R80), H119 (= H125), E165 (= E171), V168 (= V174), N297 (= N300), Y299 (= Y302), E366 (= E369)
- binding 6-phosphocyclophellitol: Q18 (= Q22), H119 (= H125), E165 (= E171), Y299 (= Y302), K337 (≠ R340), E366 (= E369), W416 (= W419), S423 (= S426), Y432 (= Y435)
5naqA Crystal structure of native 6-phospho-glucosidase lpbgl from lactobacillus plantarum (see paper)
41% identity, 96% coverage: 8:462/475 of query aligns to 4:457/461 of 5naqA
- active site: R74 (= R80), H119 (= H125), E165 (= E171), V168 (= V174), N296 (= N300), Y298 (= Y302), E365 (= E369)
- binding phosphate ion: R336 (= R340), S422 (= S426), H425 (≠ N429), N429 (= N433), Y431 (= Y435)
4ptwA Halothermothrix orenii beta-glucosidase a, 2-deoxy-2-fluoro-glucose complex (see paper)
31% identity, 97% coverage: 6:466/475 of query aligns to 1:445/445 of 4ptwA
- active site: R74 (= R80), H118 (= H125), E163 (= E171), V166 (= V174), N291 (= N300), Y293 (= Y302), E351 (= E369)
- binding 2-deoxy-2-fluoro-alpha-D-glucopyranose: Q17 (= Q22), H118 (= H125), E163 (= E171), Y293 (= Y302), E351 (= E369), W398 (= W419), E405 (≠ S426), W406 (≠ P427)
4ptvA Halothermothrix orenii beta-glucosidase a, thiocellobiose complex (see paper)
31% identity, 97% coverage: 6:466/475 of query aligns to 1:445/445 of 4ptvA
- active site: R74 (= R80), H118 (= H125), E163 (= E171), V166 (= V174), N291 (= N300), Y293 (= Y302), E351 (= E369)
- binding beta-D-glucopyranose: W324 (= W342), E405 (≠ S426), Y408 (≠ N429)
- binding 4-thio-beta-D-glucopyranose: Q17 (= Q22), H118 (= H125), E163 (= E171), Y293 (= Y302), E351 (= E369), W398 (= W419), E405 (≠ S426), W406 (≠ P427)
5yifA Pyruvylated beta-d-galactosidase from bacillus sp. Hma207, e163a mutant pyruvylated beta-d-galactose complex (see paper)
31% identity, 97% coverage: 6:464/475 of query aligns to 1:455/459 of 5yifA
- binding (2R,4aR,6R,7R,8R,8aR)-2-methyl-6,7,8-tris(oxidanyl)-4,4a,6,7,8,8a-hexahydropyrano[3,2-d][1,3]dioxine-2-carboxylic acid: Q17 (= Q22), H118 (= H125), N162 (= N170), N295 (= N300), Y297 (= Y302), W337 (= W342), E364 (= E369), W410 (= W419), S417 (= S426), W418 (≠ P427), K424 (≠ N433)
Q9FIW4 Beta-glucosidase 42; AtBGLU42; EC 3.2.1.21 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 98% coverage: 2:465/475 of query aligns to 15:483/490 of Q9FIW4
- R342 (≠ P328) Important for substrate chain length specificity; mutation R->A,Y: Highest preference on cellotetraose and cellopentaose with increased affinities at subsite (+)3.
8ivyA Beta-glucosidase bgla mutant e166q in complex with glucose (see paper)
30% identity, 96% coverage: 5:460/475 of query aligns to 3:442/451 of 8ivyA
Q75I93 Beta-glucosidase 7; Os3bglu7; EC 3.2.1.21 from Oryza sativa subsp. japonica (Rice) (see 4 papers)
32% identity, 96% coverage: 5:460/475 of query aligns to 40:501/504 of Q75I93
- E204 (= E171) active site, Proton donor
- I207 (≠ V174) mutation to V: Increases KM for substrate about 5-fold. Increases kcat/Km values 9 to 24-fold depending on the substrate.
- N218 (≠ W186) mutation to H: Decreases KM for substrate about 2-fold.
- C223 (≠ N191) modified: Disulfide link with 226
- C226 (≠ T194) modified: Disulfide link with 223
- N273 (≠ E229) mutation to V: Increases KM for substrate about 5-fold.
- E414 (= E369) active site, Nucleophile
- L470 (≠ M428) mutation to R: No effect on KM.
2o9rA Beta-glucosidase b complexed with thiocellobiose (see paper)
31% identity, 95% coverage: 9:460/475 of query aligns to 6:439/445 of 2o9rA
- active site: R76 (= R80), H119 (= H125), E164 (= E171), C167 (≠ V174), N293 (= N300), Y295 (= Y302), E353 (= E369)
- binding beta-D-glucopyranose: E164 (= E171), Y295 (= Y302), W325 (= W342), E353 (= E369), W399 (= W419), E406 (≠ S426)
7bzmA Crystal structure of rice os3bglu7 with glucoimidazole (see paper)
32% identity, 96% coverage: 5:460/475 of query aligns to 7:468/471 of 7bzmA
- active site: R81 (= R80), H125 (= H125), E171 (= E171), I174 (≠ V174), N308 (= N300), Y310 (= Y302), E381 (= E369)
- binding glucoimidazole: Q24 (= Q22), H125 (= H125), E171 (= E171), Y310 (= Y302), W353 (≠ G341), E381 (= E369), W428 (= W419), E435 (≠ S426), F444 (≠ Y435)
- binding zinc ion: D60 (= D59), H63 (≠ N62)
2rglA Rice bglu1 beta-glucosidase, a plant exoglucanase/beta-glucosidase (see paper)
32% identity, 96% coverage: 5:460/475 of query aligns to 7:468/471 of 2rglA
- active site: R81 (= R80), H125 (= H125), E171 (= E171), I174 (≠ V174), N308 (= N300), Y310 (= Y302), E381 (= E369)
- binding glycerol: E171 (= E171), Y310 (= Y302), E381 (= E369), W428 (= W419), E435 (≠ S426), F444 (≠ Y435)
- binding zinc ion: D60 (= D59), H63 (≠ N62)
6jfpA Crystal structure of the beta-glucosidase bgl15 (see paper)
31% identity, 97% coverage: 6:468/475 of query aligns to 1:444/444 of 6jfpA
3ahvA Semi-active e176q mutant of rice bglu1 covalent complex with 2-deoxy- 2-fluoroglucoside (see paper)
31% identity, 96% coverage: 5:460/475 of query aligns to 8:469/472 of 3ahvA
- active site: R82 (= R80), H126 (= H125), Q172 (≠ E171), I175 (≠ V174), N309 (= N300), Y311 (= Y302), E382 (= E369)
- binding 2-deoxy-2-fluoro-alpha-D-glucopyranose: Q25 (= Q22), H126 (= H125), N171 (= N170), Y311 (= Y302), E382 (= E369), W429 (= W419), E436 (≠ S426), F445 (≠ Y435)
- binding zinc ion: D61 (= D59), H64 (≠ N62)
3ahtA Crystal structure of rice bglu1 e176q mutant in complex with laminaribiose (see paper)
31% identity, 96% coverage: 5:460/475 of query aligns to 7:468/471 of 3ahtA
- active site: R81 (= R80), H125 (= H125), Q171 (≠ E171), I174 (≠ V174), N308 (= N300), Y310 (= Y302), E381 (= E369)
- binding beta-D-glucopyranose: Q24 (= Q22), H125 (= H125), Q171 (≠ E171), Q171 (≠ E171), Y310 (= Y302), Y310 (= Y302), W353 (≠ G341), W353 (≠ G341), E381 (= E369), W428 (= W419), E435 (≠ S426), F444 (≠ Y435)
- binding zinc ion: D60 (= D59), H63 (≠ N62)
2jieA Beta-glucosidase b from bacillus polymyxa complexed with 2-f-glucose (see paper)
30% identity, 95% coverage: 9:460/475 of query aligns to 6:439/445 of 2jieA
- active site: R76 (= R80), H119 (= H125), E164 (= E171), C167 (≠ V174), N293 (= N300), Y295 (= Y302), E353 (= E369)
- binding 2-deoxy-2-fluoro-alpha-D-glucopyranose: Q19 (= Q22), H119 (= H125), N163 (= N170), E164 (= E171), Y295 (= Y302), E353 (= E369), W399 (= W419), E406 (≠ S426), F415 (≠ Y435)
6r4kA Structure of beta-glucosidase a from paenibacillus polymyxa complexed with a monovalent inhibitor (see paper)
30% identity, 95% coverage: 9:460/475 of query aligns to 7:438/448 of 6r4kA
- binding (2~{S},3~{S},4~{R})-2-[[4-[4-[2-[2-(2-azanylidenehydrazinyl)ethoxy]ethoxy]phenyl]-1,2,3-triazol-1-yl]methyl]pyrrolidine-3,4-diol: Q20 (= Q22), H121 (= H125), E166 (= E171), L173 (≠ R178), E352 (= E369), W398 (= W419), E405 (≠ S426), W406 (≠ P427)
6qwiA Structure of beta-glucosidase a from paenibacillus polymyxa complexed with multivalent inhibitors. (see paper)
30% identity, 95% coverage: 9:460/475 of query aligns to 7:438/448 of 6qwiA
- binding (2~{S},3~{S},4~{R})-2-[[4-[4-(2-ethoxyethoxy)phenyl]-1,2,3-triazol-1-yl]methyl]pyrrolidine-3,4-diol: Q20 (= Q22), H121 (= H125), W122 (≠ Y126), E166 (= E171), L173 (≠ R178), W326 (= W342), E352 (= E369), W398 (= W419), E405 (≠ S426), W406 (≠ P427)
4ipnE The complex structure of 6-phospho-beta-glucosidase bgla-2 with thiocellobiose-6p from streptococcus pneumoniae (see paper)
30% identity, 97% coverage: 9:468/475 of query aligns to 4:462/463 of 4ipnE
3scoA Crystal structure of rice bglu1 e386g mutant complexed with alpha- glucosyl fluoride
31% identity, 96% coverage: 5:460/475 of query aligns to 8:469/472 of 3scoA
- active site: R82 (= R80), H126 (= H125), E172 (= E171), I175 (≠ V174), N309 (= N300), Y311 (= Y302), G382 (≠ E369)
- binding alpha-D-glucopyranosyl fluoride: Q25 (= Q22), H126 (= H125), N171 (= N170), E172 (= E171), Y311 (= Y302), W429 (= W419), E436 (≠ S426), F445 (≠ Y435)
- binding zinc ion: D61 (= D59), H64 (≠ N62)
1bggB Glucosidase a from bacillus polymyxa complexed with gluconate (see paper)
30% identity, 95% coverage: 9:460/475 of query aligns to 6:437/447 of 1bggB
- active site: R76 (= R80), H120 (= H125), E165 (= E171), C168 (≠ V174), N293 (= N300), Y295 (= Y303), E351 (= E369)
- binding D-gluconic acid: Q19 (= Q22), H120 (= H125), W121 (≠ Y126), N164 (= N170), E165 (= E171), Y295 (= Y303), E351 (= E369), W397 (= W419), E404 (≠ S426), W405 (≠ P427)
Query Sequence
>BWI76_RS23345 FitnessBrowser__Koxy:BWI76_RS23345
MTTVRMAIPHDFILGAAASAWQTEGWSGKKEGQDSWPDLWYKNDRHVWHNGYGPAVATDF
INRFREDVQLMKLAGLTHYRTSINWSRFLTDYENVTVDEDYAAYYDQLFDELLANGIEPM
ICLEHYELPGYLLEQYGGWASKKVVELFVQYAEKVFARYHHQVTRWFTFNEPIVVQTRVY
LDALRWPYEQNTGTWMQWNHHKVLATAKVVRLFREKGYRGTVGCILNPEVTYPRSNAPHD
VRAAERYDLFYNRVFLDPLVHGVYPPELLNLLEQHHVSWDYDAQELALIRENTVDELGIN
LYYPHRVKAPSRAWHPQTPFHPAYYYEPFELPGRRMNSSRGWEIYPQIVFDMAMRIKQDY
RNIPWFVAESGMGVENEGQFRNREGAIADDYRIRFISEHLWQTLRAREAGANCHGYMLWA
FTDNVSPMNAFKNRYGLIEIDLQNNRARRPKASASWFRKLGESRELTLDIDDEWR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory