Comparing BWI76_RS23410 FitnessBrowser__Koxy:BWI76_RS23410 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7vcpA Frischella perrara beta-fructofuranosidase in complex with fructose (see paper)
50% identity, 100% coverage: 1:477/477 of query aligns to 3:486/490 of 7vcpA
6nunA Structure of gh32 hydrolase from bifidobacterium adolescentis in complex with frutose
42% identity, 94% coverage: 20:469/477 of query aligns to 34:503/516 of 6nunA
3pijB Beta-fructofuranosidase from bifidobacterium longum - complex with fructose (see paper)
40% identity, 97% coverage: 5:465/477 of query aligns to 21:501/526 of 3pijB
7bwcA Bombyx mori gh32 beta-fructofuranosidase bmsuc1 mutant d63a in complex with sucrose (see paper)
40% identity, 93% coverage: 9:452/477 of query aligns to 10:439/464 of 7bwcA
O33833 Beta-fructosidase; Invertase; Sucrase; EC 3.2.1.26 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
36% identity, 92% coverage: 25:461/477 of query aligns to 4:417/432 of O33833
1w2tB Beta-fructosidase from thermotoga maritima in complex with raffinose (see paper)
35% identity, 92% coverage: 25:461/477 of query aligns to 4:417/432 of 1w2tB
1w2tA Beta-fructosidase from thermotoga maritima in complex with raffinose (see paper)
35% identity, 92% coverage: 25:461/477 of query aligns to 4:417/432 of 1w2tA
6nu8A Structure of sucrose-6-phosphate hydrolase from lactobacillus gasseri in complex with fructose
31% identity, 91% coverage: 27:459/477 of query aligns to 35:471/488 of 6nu8A
Q39041 Acid beta-fructofuranosidase 4, vacuolar; At beta fruct4; AtBETAFRUCT4; Acid invertase 4; AI 4; Acid sucrose hydrolase 4; Vacuolar invertase 4; Inv-V4; VAC-INV 4; VI 4; EC 3.2.1.26 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
27% identity, 95% coverage: 27:477/477 of query aligns to 124:646/664 of Q39041
Sites not aligning to the query:
3uggA Crystal structure of a 6-sst/6-sft from pachysandra terminalis in complex with 1-kestose (see paper)
27% identity, 90% coverage: 27:453/477 of query aligns to 16:488/524 of 3uggA
Q43866 Beta-fructofuranosidase, insoluble isoenzyme CWINV1; Cell wall beta-fructosidase 1; AtbetaFRUCT1; Cell wall invertase 1; AtcwINV1; Sucrose hydrolase 1; EC 3.2.1.26 from Arabidopsis thaliana (Mouse-ear cress) (see 5 papers)
26% identity, 94% coverage: 7:453/477 of query aligns to 35:551/584 of Q43866
2qquA Crystal structure of a cell-wall invertase (d239a) from arabidopsis thaliana in complex with sucrose (see paper)
26% identity, 90% coverage: 27:453/477 of query aligns to 8:504/535 of 2qquA
2aeyA Crystal structure of fructan 1-exohydrolase iia from cichorium intybus in complex with 2,5 dideoxy-2,5-immino-d-mannitol (see paper)
27% identity, 95% coverage: 27:477/477 of query aligns to 10:528/537 of 2aeyA
2addA Crystal structure of fructan 1-exohydrolase iia from cichorium intybus in complex with sucrose (see paper)
27% identity, 95% coverage: 27:477/477 of query aligns to 10:528/537 of 2addA
2ac1A Crystal structure of a cell-wall invertase from arabidopsis thaliana (see paper)
26% identity, 90% coverage: 27:453/477 of query aligns to 8:504/537 of 2ac1A
2oxbA Crystal structure of a cell-wall invertase (e203q) from arabidopsis thaliana in complex with sucrose (see paper)
26% identity, 90% coverage: 27:453/477 of query aligns to 8:504/537 of 2oxbA
Q96TU3 Extracellular exo-inulinase inuE; EC 3.2.1.80 from Aspergillus awamori (Black koji mold) (see 2 papers)
28% identity, 91% coverage: 26:458/477 of query aligns to 29:516/537 of Q96TU3
Sites not aligning to the query:
1y9gA Crystal structure of exo-inulinase from aspergillus awamori complexed with fructose (see paper)
28% identity, 91% coverage: 26:458/477 of query aligns to 10:497/517 of 1y9gA
3rwkX First crystal structure of an endo-inulinase, from aspergillus ficuum: structural analysis and comparison with other gh32 enzymes. (see paper)
26% identity, 94% coverage: 25:471/477 of query aligns to 7:485/493 of 3rwkX
O94220 Extracellular endo-inulinase inu2; 2,1-beta-D-fructanfructanohydrolase; Inulase; EC 3.2.1.7 from Aspergillus ficuum (see 2 papers)
26% identity, 94% coverage: 25:471/477 of query aligns to 30:508/516 of O94220
>BWI76_RS23410 FitnessBrowser__Koxy:BWI76_RS23410
MTYSIPRAEQELQAKHEELNLRWYPRYHLAARAGWINDPNGLVWFDGWYHAFYQHHPYST
QWGPMHWGHARSKDLVHWEHLPVALAPEGPEDKDGCFSGSAVVDGDTLALIYTGHKFHGD
PSDEANLYQVQCLATSRDGIHFERQGIVVDTPPGMHHFRDPKVWREGDSWYMIVGARDGD
TGQVRLYRSADLRQWQDAGVLDEAEKEMGYMWECPDFFALNGKHILMFSPQGLAAKGYRN
RNLFQSGYLLGEWQPGQAFVREGEFVEMDHGHDFYAPQSFLTPDGRRIVIGWLDMWESPL
PEQQDGWAGMLSLPRELSLSADNRLQMRPAKEVESMRGASFPWPVTTLKNQQTTTVENCE
AMEVILHWDCASSSAEQYGLSLGDGLRVYVDAQMQRLVLERHYPQYGLCGTRSVPLTEGA
DLKLRIFFDSSSVEVFVNDGEACLSSRIYPDAARRELALFSWSGSAYLKEAGAWQLE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory