SitesBLAST
Comparing BWI76_RS23630 FitnessBrowser__Koxy:BWI76_RS23630 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q48436 Diacetyl reductase [(S)-acetoin forming]; Acetoin(diacetyl) reductase; AR; Meso-2,3-butanediol dehydrogenase; EC 1.1.1.304 from Klebsiella pneumoniae (see paper)
56% identity, 98% coverage: 6:259/259 of query aligns to 3:256/256 of Q48436
- 6:33 (vs. 9:36, 68% identical) binding
- D59 (≠ N62) binding
- K156 (= K159) binding
1gegE Cryatal structure analysis of meso-2,3-butanediol dehydrogenase (see paper)
56% identity, 98% coverage: 6:259/259 of query aligns to 3:256/256 of 1gegE
- active site: G13 (= G16), S139 (= S142), Y152 (= Y155), K156 (= K159), V197 (≠ F200)
- binding alpha-D-glucopyranose: R63 (= R66), D64 (≠ A67), F67 (≠ Y70), E123 (≠ K126)
- binding nicotinamide-adenine-dinucleotide: G9 (= G12), Q12 (= Q15), I14 (= I17), D33 (= D36), Y34 (≠ V37), V58 (≠ A61), D59 (≠ N62), V60 (≠ I63), N86 (= N89), A87 (= A90), I109 (= I112), S139 (= S142), Y152 (= Y155), K156 (= K159), P182 (= P185), V185 (= V188), T187 (= T190), M189 (= M192)
3wyeA Crystal structure of chimeric engineered (2s,3s)-butanediol dehydrogenase complexed with NAD+
57% identity, 98% coverage: 6:259/259 of query aligns to 2:255/255 of 3wyeA
- active site: G12 (= G16), S138 (= S142), Y151 (= Y155), K155 (= K159), L196 (≠ F200)
- binding nicotinamide-adenine-dinucleotide: G8 (= G12), Q11 (= Q15), G12 (= G16), I13 (= I17), D32 (= D36), Y33 (≠ V37), V57 (≠ A61), D58 (≠ N62), V59 (≠ I63), N85 (= N89), A86 (= A90), S138 (= S142), Y151 (= Y155), K155 (= K159), P181 (= P185), G182 (= G186), V184 (= V188), T186 (= T190), M188 (= M192), W189 (= W193)
3a28C Crystal structure of l-2,3-butanediol dehydrogenase (see paper)
53% identity, 98% coverage: 5:259/259 of query aligns to 1:257/257 of 3a28C
- active site: G12 (= G16), S140 (= S142), Y153 (= Y155), K157 (= K159), L198 (≠ F200)
- binding nicotinamide-adenine-dinucleotide: G8 (= G12), Q11 (= Q15), I13 (= I17), D32 (= D36), L33 (≠ V37), Q36 (≠ N38), L59 (≠ A61), D60 (≠ N62), V61 (≠ I63), N87 (= N89), S140 (= S142), Y153 (= Y155), K157 (= K159), P183 (= P185), V186 (= V188), T188 (= T190), M190 (= M192), W191 (= W193)
Q9ZNN8 L-2,3-butanediol dehydrogenase; L-BDH; (S,S)-butanediol dehydrogenase; Diacetyl reductase [(S)-acetoin forming]; EC 1.1.1.76; EC 1.1.1.304 from Corynebacterium glutamicum (Brevibacterium saccharolyticum) (see paper)
53% identity, 98% coverage: 5:259/259 of query aligns to 2:258/258 of Q9ZNN8
- QGI 12:14 (= QGI 15:17) binding
- D33 (= D36) binding
- Q37 (≠ N38) binding
- DV 61:62 (≠ NI 62:63) binding
- N88 (= N89) binding
- I142 (= I143) mutation to Q: Loss of L-BD oxidizing activity, and does not gain the ability to use meso-BD as substrate; when associated with N-148.; mutation to Q: Loss of L-BD oxidizing activity. Does not gain the ability to use meso-BD as substrate.
- F148 (= F149) mutation to N: Loss of L-BD oxidizing activity, and does not gain the ability to use meso-BD as substrate; when associated with Q-142.; mutation to N: Loss of L-BD oxidizing activity. Does not gain the ability to use meso-BD as substrate.
- Y154 (= Y155) binding
- K158 (= K159) binding
- PGIVGT 184:189 (= PGIVGT 185:190) binding
6pejA Structure of sorbitol dehydrogenase from sinorhizobium meliloti 1021 bound to sorbitol
37% identity, 98% coverage: 3:255/259 of query aligns to 4:253/257 of 6pejA
3ak4A Crystal structure of nadh-dependent quinuclidinone reductase from agrobacterium tumefaciens
38% identity, 98% coverage: 3:256/259 of query aligns to 5:255/258 of 3ak4A
- active site: G18 (= G16), S141 (= S142), L151 (= L152), Y154 (= Y155), K158 (= K159), E199 (≠ F200)
- binding nicotinamide-adenine-dinucleotide: K17 (≠ Q15), G18 (= G16), I19 (= I17), D38 (= D36), L39 (≠ V37), V60 (≠ T58), D61 (≠ N62), V62 (≠ I63), N88 (= N89), A89 (= A90), G90 (= G91), T139 (≠ A140), S141 (= S142), Y154 (= Y155), K158 (= K159), G185 (= G186), V187 (= V188), T189 (= T190), M191 (= M192)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
39% identity, 97% coverage: 6:256/259 of query aligns to 5:244/246 of 3osuA
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
37% identity, 99% coverage: 1:257/259 of query aligns to 1:246/247 of 4jroC
- active site: G16 (= G16), S142 (= S142), Q152 (≠ L152), Y155 (= Y155), K159 (= K159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (≠ G14), R15 (≠ Q15), G16 (= G16), I17 (= I17), N35 (vs. gap), Y36 (≠ V35), N37 (≠ D36), G38 (≠ V37), S39 (≠ N38), N63 (= N62), V64 (≠ I63), N90 (= N89), A91 (= A90), I93 (= I92), I113 (= I112), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), I188 (≠ V188), T190 (= T190)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
38% identity, 97% coverage: 6:256/259 of query aligns to 2:237/239 of 3sj7A
- active site: G12 (= G16), S138 (= S142), Q148 (≠ L152), Y151 (= Y155), K155 (= K159)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G12), S10 (≠ G14), R11 (≠ Q15), I13 (= I17), N31 (= N38), Y32 (vs. gap), A33 (vs. gap), G34 (vs. gap), S35 (vs. gap), A58 (= A61), N59 (= N62), V60 (≠ I63), N86 (= N89), A87 (= A90), T109 (≠ I112), S138 (= S142), Y151 (= Y155), K155 (= K159), P181 (= P185), G182 (= G186)
6j7uA Crystal structure of blue fluorescent protein from metagenomic library in complex with NADPH (see paper)
38% identity, 98% coverage: 3:256/259 of query aligns to 3:245/247 of 6j7uA
- active site: G16 (= G16), S142 (= S142), Y156 (= Y155)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (≠ G14), R15 (≠ Q15), I17 (= I17), Y36 (vs. gap), V37 (= V35), S38 (≠ D36), S41 (≠ P39), D65 (≠ N62), S66 (≠ I63), N92 (= N89), A93 (= A90), G94 (= G91), I115 (= I112), G141 (≠ C141), S142 (= S142), Y156 (= Y155), K160 (= K159), P186 (= P185), T191 (= T190), M193 (= M192), N194 (≠ W193)
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
38% identity, 97% coverage: 7:256/259 of query aligns to 3:242/244 of 1edoA
- active site: G12 (= G16), S138 (= S142), Y151 (= Y155), K155 (= K159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G12), S10 (≠ G14), R11 (≠ Q15), I13 (= I17), N31 (≠ D36), Y32 (≠ V37), A33 (≠ N38), R34 (≠ P39), S35 (≠ E40), D59 (≠ N62), V60 (≠ I63), N86 (= N89), A87 (= A90), S138 (= S142), Y151 (= Y155), K155 (= K159), P181 (= P185), G182 (= G186), I184 (≠ V188), S186 (≠ T190), M188 (= M192)
5u9pB Crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP and tartrate
36% identity, 98% coverage: 3:257/259 of query aligns to 14:258/261 of 5u9pB
- active site: G27 (= G16), S152 (= S142), Y165 (= Y155), K169 (= K159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G12), R26 (≠ Q15), G27 (= G16), I28 (= I17), R48 (≠ V37), D73 (≠ N62), V74 (≠ I63), N100 (= N89), A101 (= A90), I150 (≠ A140), Y165 (= Y155), K169 (= K159), P195 (= P185), F198 (≠ V188), T200 (= T194), L202 (≠ I196), N203 (≠ D197)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
34% identity, 98% coverage: 1:255/259 of query aligns to 1:242/248 of Q9KJF1
- M1 (= M1) modified: Initiator methionine, Removed
- S15 (≠ Q15) binding
- D36 (= D36) binding
- D62 (≠ N62) binding
- I63 (= I63) binding
- N89 (= N89) binding
- Y153 (= Y155) binding
- K157 (= K159) binding
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
37% identity, 99% coverage: 1:257/259 of query aligns to 4:246/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G12), R18 (≠ Q15), G19 (= G16), I20 (= I17), D39 (= D36), R40 (≠ V37), C63 (≠ A61), I65 (= I63), N91 (= N89), G93 (= G91), I94 (= I92), V114 (≠ I112), Y155 (= Y155), K159 (= K159), I188 (≠ V188), T190 (= T190), T193 (≠ I203)
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
34% identity, 98% coverage: 3:255/259 of query aligns to 2:241/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), M16 (≠ I17), D35 (= D36), I36 (≠ V37), I62 (= I63), N88 (= N89), G90 (= G91), I138 (≠ A140), S140 (= S142), Y152 (= Y155), K156 (= K159), I185 (≠ V188)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
34% identity, 98% coverage: 3:257/259 of query aligns to 5:243/244 of 4nbuB
- active site: G18 (= G16), N111 (= N113), S139 (= S142), Q149 (≠ L152), Y152 (= Y155), K156 (= K159)
- binding acetoacetyl-coenzyme a: D93 (≠ V95), K98 (≠ D100), S139 (= S142), N146 (≠ F149), V147 (≠ A150), Q149 (≠ L152), Y152 (= Y155), F184 (≠ I187), M189 (= M192), K200 (≠ I203)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G12), N17 (≠ Q15), G18 (= G16), I19 (= I17), D38 (= D36), F39 (≠ V37), V59 (≠ A61), D60 (≠ N62), V61 (≠ I63), N87 (= N89), A88 (= A90), G89 (= G91), I90 (= I92), T137 (≠ A140), S139 (= S142), Y152 (= Y155), K156 (= K159), P182 (= P185), F184 (≠ I187), T185 (≠ V188), T187 (= T190), M189 (= M192)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
34% identity, 99% coverage: 1:256/259 of query aligns to 4:240/243 of 4i08A
- active site: G19 (= G16), N113 (= N113), S141 (= S142), Q151 (≠ L152), Y154 (= Y155), K158 (= K159)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G12), S17 (≠ G14), R18 (≠ Q15), I20 (= I17), T40 (≠ V37), N62 (= N62), V63 (≠ I63), N89 (= N89), A90 (= A90), G140 (≠ C141), S141 (= S142), Y154 (= Y155), K158 (= K159), P184 (= P185), G185 (= G186), T189 (= T190)
4cqlI Crystal structure of heterotetrameric human ketoacyl reductase complexed with NAD (see paper)
34% identity, 98% coverage: 3:256/259 of query aligns to 6:249/251 of 4cqlI
- active site: G19 (= G16), S146 (= S142), Y159 (= Y155), K163 (= K159)
- binding nicotinamide-adenine-dinucleotide: S18 (≠ Q15), G19 (= G16), I20 (= I17), D39 (= D36), L40 (≠ V37), A64 (= A64), D65 (= D65), V66 (≠ R66), C93 (≠ N89), A94 (= A90), G95 (= G91), I96 (= I92), V116 (≠ I112), I144 (≠ A140), S146 (= S142), Y159 (= Y155), K163 (= K159), P189 (= P185), G190 (= G186), I192 (≠ V188), T194 (= T190), M196 (= M192)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
33% identity, 99% coverage: 1:256/259 of query aligns to 4:244/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G12), S17 (≠ G14), R18 (≠ Q15), I20 (= I17), T40 (≠ V37), N62 (= N62), V63 (≠ I63), N89 (= N89), A90 (= A90), I92 (= I92), V139 (≠ A140), S141 (= S142), Y154 (= Y155), K158 (= K159), P184 (= P185), G185 (= G186), I187 (≠ V188), T189 (= T190), M191 (= M192)
Query Sequence
>BWI76_RS23630 FitnessBrowser__Koxy:BWI76_RS23630
MAIENKVALVTGAGQGIGRGIALRLAKDGASLMLVDVNPEGIAAVAAEVEALGRKAATFV
ANIADRAQVYAAIDEAEKQLGGFDIIVNNAGIAQVQALADVTPEEVDRIMRINVQGTLWG
IQAAAKKFIDRQQKGKIINACSIAGHDGFALLGVYSATKFAVRALTQAAAKEYASRGITV
NAYCPGIVGTGMWTEIDKRFAEITGAPVGETYKKYVEGIALGRAETPDDVASLVSYLAGP
DSDYVTGQSILIDGGIVYR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory