Comparing BWI76_RS23660 FitnessBrowser__Koxy:BWI76_RS23660 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09099 Xylulose kinase; XK; Xylulokinase; 1-deoxy-D-xylulokinase; EC 2.7.1.17; EC 2.7.1.- from Escherichia coli (strain K12) (see paper)
31% identity, 96% coverage: 6:485/501 of query aligns to 3:478/484 of P09099
2itmA Crystal structure of the e. Coli xylulose kinase complexed with xylulose (see paper)
30% identity, 96% coverage: 6:485/501 of query aligns to 3:470/476 of 2itmA
3ll3A The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
26% identity, 98% coverage: 5:493/501 of query aligns to 5:491/492 of 3ll3A
5ya2A Crystal structure of lsrk-hpr complex with adp (see paper)
29% identity, 94% coverage: 2:473/501 of query aligns to 2:473/478 of 5ya2A
5ya1A Crystal structure of lsrk-hpr complex with atp (see paper)
29% identity, 94% coverage: 2:473/501 of query aligns to 2:473/478 of 5ya1A
3ll3B The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
26% identity, 98% coverage: 5:493/501 of query aligns to 4:489/490 of 3ll3B
6k76A Glycerol kinase form thermococcus kodakarensis, complex structure with substrate.
27% identity, 88% coverage: 5:447/501 of query aligns to 1:440/485 of 6k76A
3kzbA Crystal structure of xylulokinase from chromobacterium violaceum
30% identity, 83% coverage: 5:422/501 of query aligns to 6:430/498 of 3kzbA
6udeB Crystal structure of glycerol kinase from elizabethkingia anophelis nuhp1 in complex with adp and glycerol
24% identity, 88% coverage: 5:445/501 of query aligns to 5:450/495 of 6udeB
Q9NJP9 Glycerol kinase, glycosomal; GK; Glycerokinase; ATP:glycerol 3-phosphotransferase; EC 2.7.1.30 from Trypanosoma brucei brucei (see 2 papers)
25% identity, 83% coverage: 7:422/501 of query aligns to 6:442/512 of Q9NJP9
Sites not aligning to the query:
6jafA Crystal structure of trypanosoma brucei gambiense glycerol kinase complex with ppi (pyrophosphatase reaction)
25% identity, 83% coverage: 7:422/501 of query aligns to 8:444/513 of 6jafA
6j9qA Crystal structure of trypanosoma brucei gambiense glycerol kinase complex with amp-pnp.
25% identity, 83% coverage: 7:422/501 of query aligns to 8:444/513 of 6j9qA
5aziA Crystal structure of glycerol kinase from trypanosoma brucei gambiense complexed with 4np (see paper)
25% identity, 83% coverage: 7:422/501 of query aligns to 8:444/513 of 5aziA
3wxlA Crystal structure of trypanosoma brucei gambiense glycerol kinase complex with adp, mg2+, and glycerol (see paper)
25% identity, 83% coverage: 7:422/501 of query aligns to 8:444/513 of 3wxlA
3wxjB Crystal structure of trypanosoma brucei gambiense glycerol kinase in complex with glycerol 3-phosphate (see paper)
25% identity, 83% coverage: 7:422/501 of query aligns to 8:444/513 of 3wxjB
5gn6A Crystal structure of glycerol kinase from trypanosoma brucei gambiense complexed with cumarin derivative-17b (see paper)
25% identity, 83% coverage: 7:422/501 of query aligns to 8:444/513 of 5gn6A
5gn5A Crystal structure of glycerol kinase from trypanosoma brucei gambiense complexed with cumarin derivative-17 (see paper)
25% identity, 83% coverage: 7:422/501 of query aligns to 8:444/513 of 5gn5A
P18157 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Bacillus subtilis (strain 168) (see paper)
23% identity, 93% coverage: 1:465/501 of query aligns to 1:472/496 of P18157
3h3nX Glycerol kinase h232r with glycerol (see paper)
25% identity, 89% coverage: 2:448/501 of query aligns to 3:457/501 of 3h3nX
O34153 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus casseliflavus (Enterococcus flavescens) (see 3 papers)
25% identity, 89% coverage: 2:448/501 of query aligns to 4:458/506 of O34153
>BWI76_RS23660 FitnessBrowser__Koxy:BWI76_RS23660
MKDKILTIDVGTGSTRAAILRVDGTMVGFAQREYEQTTPRAGWSEQAPSLWWRAACECIR
EVLYRYPETVTQIAVIGACGQMHGTVLLDDCGELVEDRALLWNDKRSQPQVDAFAAREGR
EKWLAHLNNPPAAAWPAFKLAWWREHHPERWPKLAKVLMPKDYINFMLTGALATDYSEAS
CYFLMDSETRAWSSQACETFGLRVDQLPELKLSSDIIGQVTPRASDTTGLPVGIPVVAGT
SDMAASLLGSGVYEPGMASDSTGTSTLITVVSQRPLRHPLVNNLHLANAAWGGFTILDAG
GDAVRWARLALADNQITHPQLLQEAAAVPAGAEGLLFLPYLTGERLAEHTNSRAQFFGLQ
RKHRRGHLFRAVLEGVAFASWRNLRQLQACGQYPQQMIASGGGARSPLWLEIKAAAYNLP
ILSTRNQENGVTGCGIIAGVGAGLYADFASGVRQTVQFDKLISPDPRLRDYYQACSELFD
TLYQQSATLYDRLDALSAGPD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory