Comparing BWI76_RS23665 FitnessBrowser__Koxy:BWI76_RS23665 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
3ngjD Crystal structure of a putative deoxyribose-phosphate aldolase from entamoeba histolytica
38% identity, 87% coverage: 12:227/249 of query aligns to 4:214/222 of 3ngjD
Sites not aligning to the query:
Q4ZMV1 Deoxyribose-phosphate aldolase; DERA; 2-deoxy-D-ribose 5-phosphate aldolase; Phosphodeoxyriboaldolase; Deoxyriboaldolase; EC 4.1.2.4 from Pseudomonas syringae pv. syringae (strain B728a) (see paper)
46% identity, 59% coverage: 81:227/249 of query aligns to 67:213/226 of Q4ZMV1
Sites not aligning to the query:
1ub3A Crystal structure of tetrameric structure of aldolase from thermus thermophilus hb8 (see paper)
35% identity, 82% coverage: 24:227/249 of query aligns to 6:206/211 of 1ub3A
6z9iB Escherichia coli d-2-deoxyribose-5-phosphate aldolase - n21k mutant complex with reaction products (see paper)
29% identity, 85% coverage: 13:223/249 of query aligns to 2:222/248 of 6z9iB
Sites not aligning to the query:
P0A6L0 Deoxyribose-phosphate aldolase; DERA; 2-deoxy-D-ribose 5-phosphate aldolase; Phosphodeoxyriboaldolase; Deoxyriboaldolase; EC 4.1.2.4 from Escherichia coli (strain K12) (see 2 papers)
29% identity, 85% coverage: 13:223/249 of query aligns to 4:224/259 of P0A6L0
Sites not aligning to the query:
5el1A Crystal structure of deoxyribose-phosphate aldolase from escherichia coli (k58e-y96w mutant) after acetaldehyde treatment (see paper)
29% identity, 85% coverage: 13:223/249 of query aligns to 2:222/248 of 5el1A
Sites not aligning to the query:
5ekyA Crystal structure of deoxyribose-phosphate aldolase from escherichia coli (k58e-y96w mutant) (see paper)
29% identity, 85% coverage: 13:223/249 of query aligns to 2:222/248 of 5ekyA
Sites not aligning to the query:
1jcjA Observation of covalent intermediates in an enzyme mechanism at atomic resolution (see paper)
28% identity, 85% coverage: 13:223/249 of query aligns to 5:225/252 of 1jcjA
Sites not aligning to the query:
7p76A Re-engineered 2-deoxy-d-ribose-5-phosphate aldolase catalysing asymmetric michael addition reactions, schiff base complex with cinnamaldehyde (see paper)
30% identity, 73% coverage: 13:194/249 of query aligns to 1:187/247 of 7p76A
Q9Y315 Deoxyribose-phosphate aldolase; DERA; 2-deoxy-D-ribose 5-phosphate aldolase; Phosphodeoxyriboaldolase; Deoxyriboaldolase; EC 4.1.2.4 from Homo sapiens (Human) (see paper)
31% identity, 51% coverage: 82:207/249 of query aligns to 128:261/318 of Q9Y315
3q2dA Optimization of the in silico designed kemp eliminase ke70 by computational design and directed evolution (see paper)
30% identity, 59% coverage: 49:194/249 of query aligns to 38:186/246 of 3q2dA
Sites not aligning to the query:
8forA Crystal structure of kemp eliminase ke70-core with bound transition state analogue
30% identity, 57% coverage: 52:194/249 of query aligns to 43:188/249 of 8forA
Sites not aligning to the query:
>BWI76_RS23665 FitnessBrowser__Koxy:BWI76_RS23665
MKVIKNKEQDETMNETTRRFARLVDLSAVQATSTEADVRACAELAARYNIISVHVLPCWT
RFLSTLLPQQGTGEVMIGGPVGFPGGGHATDTKVQEVRQLIADGAREVDMVVNIGKVLSG
DYDYVREDLRRVVDAAAPVPAKVILETHYLNEEQIRRVCDIAVEVGMKWVKTSTGWAPTG
ATVEKVSIIADQLKGRIDIKGAGGIRDLATVRALYQLGIRRFGMSHGAVSKVLTELEQHP
ERFPELNAD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory