SitesBLAST
Comparing BWI76_RS23705 FitnessBrowser__Koxy:BWI76_RS23705 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
97% identity, 100% coverage: 1:244/244 of query aligns to 4:247/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G12), R18 (= R15), G19 (= G16), I20 (= I17), D39 (= D36), R40 (= R37), C63 (= C60), I65 (= I62), N91 (= N88), G93 (= G90), I94 (= I91), V114 (= V111), Y155 (= Y152), K159 (= K156), I188 (= I185), T190 (= T187), T193 (= T190)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
48% identity, 100% coverage: 1:244/244 of query aligns to 1:247/247 of 4jroC
- active site: G16 (= G16), S142 (= S140), Q152 (= Q149), Y155 (= Y152), K159 (= K156)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (≠ A14), R15 (= R15), G16 (= G16), I17 (= I17), N35 (≠ D36), Y36 (≠ R37), N37 (≠ D38), G38 (≠ A39), S39 (≠ H40), N63 (= N61), V64 (≠ I62), N90 (= N88), A91 (= A89), I93 (= I91), I113 (≠ V111), S142 (= S140), Y155 (= Y152), K159 (= K156), P185 (= P182), I188 (= I185), T190 (= T187)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
45% identity, 100% coverage: 1:244/244 of query aligns to 1:246/246 of 3osuA
4nbuB Crystal structure of fabg from bacillus sp (see paper)
46% identity, 100% coverage: 2:244/244 of query aligns to 4:244/244 of 4nbuB
- active site: G18 (= G16), N111 (= N112), S139 (= S140), Q149 (= Q149), Y152 (= Y152), K156 (= K156)
- binding acetoacetyl-coenzyme a: D93 (= D94), K98 (= K99), S139 (= S140), N146 (= N146), V147 (= V147), Q149 (= Q149), Y152 (= Y152), F184 (= F184), M189 (= M189), K200 (≠ I200)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G12), N17 (≠ R15), G18 (= G16), I19 (= I17), D38 (= D36), F39 (≠ R37), V59 (≠ C60), D60 (≠ N61), V61 (≠ I62), N87 (= N88), A88 (= A89), G89 (= G90), I90 (= I91), T137 (≠ I138), S139 (= S140), Y152 (= Y152), K156 (= K156), P182 (= P182), F184 (= F184), T185 (≠ I185), T187 (= T187), M189 (= M189)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
46% identity, 98% coverage: 5:244/244 of query aligns to 1:239/239 of 3sj7A
- active site: G12 (= G16), S138 (= S140), Q148 (= Q149), Y151 (= Y152), K155 (= K156)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G12), S10 (≠ A14), R11 (= R15), I13 (= I17), N31 (vs. gap), Y32 (vs. gap), A33 (= A35), G34 (≠ D36), S35 (≠ R37), A58 (≠ C60), N59 (= N61), V60 (≠ I62), N86 (= N88), A87 (= A89), T109 (≠ V111), S138 (= S140), Y151 (= Y152), K155 (= K156), P181 (= P182), G182 (= G183)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
45% identity, 100% coverage: 1:244/244 of query aligns to 1:245/248 of Q9KJF1
- M1 (= M1) modified: Initiator methionine, Removed
- S15 (≠ R15) binding
- D36 (= D36) binding
- D62 (≠ N61) binding
- I63 (= I62) binding
- N89 (= N88) binding
- Y153 (= Y152) binding
- K157 (= K156) binding
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
45% identity, 99% coverage: 3:244/244 of query aligns to 2:244/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), M16 (≠ I17), D35 (= D36), I36 (≠ R37), I62 (= I62), N88 (= N88), G90 (= G90), I138 (= I138), S140 (= S140), Y152 (= Y152), K156 (= K156), I185 (= I185)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
42% identity, 100% coverage: 1:244/244 of query aligns to 4:246/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G12), S17 (≠ A14), R18 (= R15), I20 (= I17), T40 (≠ L48), N62 (= N61), V63 (≠ I62), N89 (= N88), A90 (= A89), I92 (= I91), V139 (≠ I138), S141 (= S140), Y154 (= Y152), K158 (= K156), P184 (= P182), G185 (= G183), I187 (= I185), T189 (= T187), M191 (= M189)
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
43% identity, 98% coverage: 5:244/244 of query aligns to 1:244/244 of 1edoA
- active site: G12 (= G16), S138 (= S140), Y151 (= Y152), K155 (= K156)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G12), S10 (≠ A14), R11 (= R15), I13 (= I17), N31 (vs. gap), Y32 (vs. gap), A33 (= A35), R34 (≠ D36), S35 (≠ R37), D59 (≠ N61), V60 (≠ I62), N86 (= N88), A87 (= A89), S138 (= S140), Y151 (= Y152), K155 (= K156), P181 (= P182), G182 (= G183), I184 (= I185), S186 (≠ T187), M188 (= M189)
4dmmB 3-oxoacyl-[acyl-carrier-protein] reductase from synechococcus elongatus pcc 7942 in complex with NADP
45% identity, 100% coverage: 1:244/244 of query aligns to 1:239/240 of 4dmmB
- active site: G16 (= G16), S142 (= S140), Q152 (= Q149), Y155 (= Y152), K159 (= K156)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (≠ A14), R15 (= R15), G16 (= G16), I17 (= I17), A37 (≠ R37), S38 (≠ D38), S39 (≠ A39), A62 (≠ C60), D63 (≠ N61), V64 (≠ I62), N90 (= N88), A91 (= A89), L113 (≠ V111), I140 (= I138), S142 (= S140), Y155 (= Y152), K159 (= K156), P185 (= P182), G186 (= G183), I188 (= I185), T190 (= T187), M192 (= M189)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
41% identity, 100% coverage: 1:244/244 of query aligns to 1:243/244 of P0AEK2
- GASR 12:15 (≠ GAAR 12:15) binding
- T37 (≠ R37) binding
- NV 59:60 (≠ NI 61:62) binding
- N86 (= N88) binding
- Y151 (= Y152) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YSASK 152:156) binding
- A154 (≠ S155) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K156) mutation to A: Defect in the affinity for NADPH.
- I184 (= I185) binding
- E233 (= E234) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
43% identity, 99% coverage: 3:244/244 of query aligns to 4:246/247 of P73574
- A14 (= A13) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (≠ V147) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K156) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (= F184) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (vs. gap) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
42% identity, 98% coverage: 6:244/244 of query aligns to 5:242/243 of 1q7bA
- active site: G15 (= G16), E101 (≠ D104), S137 (= S140), Q147 (= Q149), Y150 (= Y152), K154 (= K156)
- binding calcium ion: E232 (= E234), T233 (≠ V235)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G12), S13 (≠ A14), R14 (= R15), T36 (≠ R37), N58 (= N61), V59 (≠ I62), N85 (= N88), A86 (= A89), G87 (= G90), I88 (= I91), S137 (= S140), Y150 (= Y152), K154 (= K156), P180 (= P182), G181 (= G183), I183 (= I185)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
41% identity, 100% coverage: 1:244/244 of query aligns to 1:243/244 of P0A2C9
- M125 (= M127) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (= A224) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S225) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
41% identity, 100% coverage: 1:244/244 of query aligns to 1:243/244 of 6t77A
- active site: G16 (= G16), S138 (= S140), Y151 (= Y152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (≠ A14), R15 (= R15), T37 (≠ A44), L58 (≠ C60), N59 (= N61), V60 (≠ I62), A87 (= A89), G88 (= G90), I89 (= I91)
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
41% identity, 98% coverage: 6:244/244 of query aligns to 5:242/243 of 1q7cA
- active site: G15 (= G16), S137 (= S140), Q147 (= Q149), F150 (≠ Y152), K154 (= K156)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G12), S13 (≠ A14), R14 (= R15), A35 (≠ D36), T36 (≠ R37), L57 (≠ I58), N58 (= N61), V59 (≠ I62), G87 (= G90), I88 (= I91)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
41% identity, 100% coverage: 1:244/244 of query aligns to 4:242/243 of 4i08A
- active site: G19 (= G16), N113 (= N112), S141 (= S140), Q151 (= Q149), Y154 (= Y152), K158 (= K156)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G12), S17 (≠ A14), R18 (= R15), I20 (= I17), T40 (≠ L48), N62 (= N61), V63 (≠ I62), N89 (= N88), A90 (= A89), G140 (≠ A139), S141 (= S140), Y154 (= Y152), K158 (= K156), P184 (= P182), G185 (= G183), T189 (= T187)
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
42% identity, 100% coverage: 2:244/244 of query aligns to 2:239/239 of 4nbtA
- active site: G16 (= G16), S132 (= S140), Y145 (= Y152), K149 (= K156)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), K15 (≠ R15), G16 (= G16), L17 (≠ I17), D36 (= D36), L37 (≠ A45), L52 (≠ C60), N53 (= N61), V54 (≠ I62), N80 (= N88), A81 (= A89), G82 (= G90), I130 (= I138), S132 (= S140), Y145 (= Y152), K149 (= K156), P177 (= P182), G178 (= G183), I180 (= I185), T182 (= T187)
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
40% identity, 98% coverage: 6:244/244 of query aligns to 5:242/243 of 7emgB
P71534 3-oxoacyl-[acyl-carrier-protein] reductase MabA; 3-ketoacyl-acyl carrier protein reductase; Acetoacetyl-CoA reductase; Beta-ketoacyl-ACP reductase; Beta-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100; EC 1.1.1.36 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
42% identity, 98% coverage: 3:242/244 of query aligns to 21:251/255 of P71534
Query Sequence
>BWI76_RS23705 FitnessBrowser__Koxy:BWI76_RS23705
MKLASKTAIVTGAARGIGFGIAQVLAREGARVIIADRDAHGEAAAASLRESGAQALFISC
NIGDKAQVEALFSQAEEAFGAVDIVVNNAGINRDAMLHKLSEADWDTVIDVNLKGTFLCM
QQAAIRMRERGAGRIINIASASWLGNVGQTNYSASKAGVVGMTKTACRELAKKGVTVNAI
CPGFIDTDMTRGVPENVWQIMINKIPAGYAGEAKDVGECVAFLASDGARYINGEVINVGG
GMVL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory