SitesBLAST
Comparing BWI76_RS23715 FitnessBrowser__Koxy:BWI76_RS23715 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
P53322 High-affinity nicotinic acid transporter; Nicotinic acid permease from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
28% identity, 74% coverage: 15:345/445 of query aligns to 82:412/534 of P53322
- K283 (≠ S217) modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
23% identity, 91% coverage: 23:426/445 of query aligns to 14:422/430 of P0AA76
- Y29 (≠ F37) binding
- D31 (= D39) mutation to N: Loss of galactonate transport activity.
- R32 (= R40) binding
- Y64 (= Y72) binding
- E118 (= E126) mutation to Q: Loss of galactonate transport activity.
- W358 (≠ F361) binding
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
23% identity, 91% coverage: 23:426/445 of query aligns to 3:403/409 of 6e9nA
6e9oA E. Coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form (see paper)
23% identity, 91% coverage: 23:426/445 of query aligns to 6:387/393 of 6e9oA
Q8BN82 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Mus musculus (Mouse) (see paper)
21% identity, 52% coverage: 66:296/445 of query aligns to 113:335/495 of Q8BN82
- H183 (≠ I134) mutation to R: Abolishes sialic acid transporter activity. Does not affect L-aspartate and L-glutamate transporter activity.
Sites not aligning to the query:
- 39 R→C: Completely abolishes L-aspartate and L-glutamate transporter activity. Retains appreciable H(+)-coupled sialic acid transporter activity.
Q9NRA2 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Membrane glycoprotein HP59; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Homo sapiens (Human) (see 8 papers)
21% identity, 53% coverage: 66:299/445 of query aligns to 113:338/495 of Q9NRA2
- K136 (≠ R89) to E: in SD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transporter activity, but retains appreciable H(+)-coupled sialic acid transporter activity; dbSNP:rs80338795
- H183 (≠ I134) to R: in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity; dbSNP:rs119491109
- LL 198:199 (≠ AT 149:150) mutation to AA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- IL 266:267 (≠ IT 223:224) mutation to LA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- SSLRN 268:272 (≠ AVLEK 225:229) natural variant: Missing (in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity)
- G328 (= G289) to E: in ISSD; some patients may manifest a milder phenotype consistent with Salla disease; markedly decreases H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs386833996
- P334 (= P295) to R: in ISSD; does not affect intracellular localization, targeted to lysosomes; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs119491110
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane.; LL→GG: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R → C: in SD; frequent variant in Finland; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transport activity, but retains appreciable H(+)-coupled sialic acid and nitrate transporter activity; dbSNP:rs80338794
- 371 G → V: in ISSD; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs777862172
Q5Q0U0 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 (Anion/sugar transporter), member 5; Vesicular excitatory amino acid transporter; VEAT from Rattus norvegicus (Rat) (see 2 papers)
22% identity, 52% coverage: 66:296/445 of query aligns to 113:335/495 of Q5Q0U0
- K136 (≠ R89) mutation to E: Markedly decreases H(+)-coupled sialic acid transporter activity.
- R168 (= R119) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- E171 (≠ L122) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-175.
- G172 (= G123) mutation to C: Decreases protein levels and alters subcellular localization.
- E175 (= E126) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-171.
- G176 (≠ A127) mutation to C: Decreases protein levels and alters subcellular localization.
- F179 (≠ Y130) mutation to C: Decreases the affinity and transport rate for D-glucuronate. Does not affect H(+)-coupled sialic acid transporter activity.
- P180 (= P131) mutation to C: Decreases protein levels and alters subcellular localization.
- H183 (≠ I134) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
- W186 (≠ L137) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- SSLKN 268:272 (≠ AVLEK 225:229) mutation Missing: Abolishes H(+)-coupled sialic acid transporter activity.
- P334 (= P295) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R→C: Markedly decreases H(+)-coupled sialic acid transporter activity.
- 371 G→V: Remains in the endoplasmic reticulum.
Q03567 Uncharacterized transporter slc-17.2 from Caenorhabditis elegans (see paper)
26% identity, 53% coverage: 68:305/445 of query aligns to 90:330/493 of Q03567
Sites not aligning to the query:
- 69 modified: carbohydrate, N-linked (GlcNAc...) asparagine
Query Sequence
>BWI76_RS23715 FitnessBrowser__Koxy:BWI76_RS23715
MSAINEKAVNGTQLQRTHKKIYRHLMPLLIVAYIISFIDRTNIGMAKATMSVDIGLSATA
FGLGAGLFFLTYAVLEIPSNLFLTRIGARRWIARIMITWGIISCGMAFVTGPTSFYVMRL
LLGAAEAGLYPGIIYYLTLWFGREERAKATGLFLLGVCLANIIGAPLGGLLLSLDGMSGW
HGWQWMFFIEGLPAIALAFVVWRRLPDKPADARWLDSHDVQAITAVLEKEAEETRHTPSR
FSLKTALTTRVFLLLVLIYFTHQFSVYGLSYFLPGIIGSWGQLTPLQIGLLTAIPWIAAA
AGGILLPRFARTEQRSRSMLMAGYLVMATGMAIGAIAGHGVALLGFSLAAFMFFAMQSII
FNWLPSIMSGHMLAGSFGLLNCLGLCGGFLGPFILGAFEDRTGAATSGLWFAVALLIVGA
LASLLIKSSSSSTPASAKQARGENA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory