Comparing BWI76_RS23975 FitnessBrowser__Koxy:BWI76_RS23975 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AB71 Fructose-bisphosphate aldolase class 2; FBP aldolase; FBPA; Fructose-1,6-bisphosphate aldolase; Fructose-bisphosphate aldolase class II; Sedoheptulose bisphosphate aldolase; EC 4.1.2.13 from Escherichia coli (strain K12) (see 11 papers)
94% identity, 100% coverage: 1:359/359 of query aligns to 1:359/359 of P0AB71
1dosA Structure of fructose-bisphosphate aldolase (see paper)
94% identity, 100% coverage: 2:359/359 of query aligns to 1:358/358 of 1dosA
1b57A Class ii fructose-1,6-bisphosphate aldolase in complex with phosphoglycolohydroxamate (see paper)
91% identity, 100% coverage: 2:359/359 of query aligns to 1:346/346 of 1b57A
5vjeA Class ii fructose-1,6-bisphosphate aldolase of escherichia coli with d-glucitol 1,6-bisphosphate (see paper)
89% identity, 100% coverage: 2:359/359 of query aligns to 1:339/339 of 5vjeA
5gk5C Apo structure of fructose 1,6-bisphosphate aldolase from escherichia coli at 1.9 angstrom resolution
87% identity, 100% coverage: 2:359/359 of query aligns to 1:335/335 of 5gk5C
1gynA Class ii fructose 1,6-bisphosphate aldolase with cadmium (not zinc) in the active site (see paper)
87% identity, 100% coverage: 2:359/359 of query aligns to 1:333/333 of 1gynA
3qm3A 1.85 angstrom resolution crystal structure of fructose-bisphosphate aldolase (fba) from campylobacter jejuni
63% identity, 99% coverage: 4:357/359 of query aligns to 4:348/350 of 3qm3A
7rgnA Crystal structure of putative fructose-1,6-bisphosphate aldolase from candida auris
51% identity, 96% coverage: 9:351/359 of query aligns to 7:332/340 of 7rgnA
P36580 Fructose-bisphosphate aldolase; FBP aldolase; FBPA; Fructose-1,6-bisphosphate aldolase; EC 4.1.2.13 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
50% identity, 99% coverage: 4:359/359 of query aligns to 3:358/358 of P36580
7v6gB Structure of candida albicans fructose-1,6-bisphosphate aldolase mutation c157s with cn39
50% identity, 95% coverage: 9:350/359 of query aligns to 7:329/338 of 7v6gB
Sites not aligning to the query:
7yvaB Crystal structure of candida albicans fructose-1,6-bisphosphate aldolase complexed with lipoic acid
50% identity, 95% coverage: 9:350/359 of query aligns to 7:327/336 of 7yvaB
Sites not aligning to the query:
7v6fA Structure of candida albicans fructose-1,6-bisphosphate aldolase complexed with g3p
49% identity, 95% coverage: 9:350/359 of query aligns to 7:326/335 of 7v6fA
4delA Active site loop dynamics of a class iia fructose 1,6-bisphosphate aldolase from m. Tuberculosis (see paper)
41% identity, 92% coverage: 25:354/359 of query aligns to 15:335/345 of 4delA
Sites not aligning to the query:
3ekzA Structural characterization of tetrameric mycobacterium tuberculosis fructose 1,6-bisphosphate aldolase - substrate binding and catalysis mechanism of a class iia bacterial aldolase (see paper)
39% identity, 92% coverage: 25:354/359 of query aligns to 15:324/334 of 3ekzA
Sites not aligning to the query:
4a22A Structure of mycobacterium tuberculosis fructose 1,6-bisphosphate aldolase bound to n-(4-hydroxybutyl)- glycolohydroxamic acid bis- phosphate (see paper)
39% identity, 92% coverage: 25:354/359 of query aligns to 15:322/329 of 4a22A
3elfA Structural characterization of tetrameric mycobacterium tuberculosis fructose 1,6-bisphosphate aldolase - substrate binding and catalysis mechanism of a class iia bacterial aldolase (see paper)
39% identity, 92% coverage: 25:354/359 of query aligns to 15:322/332 of 3elfA
Sites not aligning to the query:
4lv4A A noncompetitive inhibitor for m. Tuberculosis's class iia fructose 1, 6-bisphosphate aldolase (see paper)
37% identity, 92% coverage: 25:354/359 of query aligns to 15:310/320 of 4lv4A
Sites not aligning to the query:
P13243 Probable fructose-bisphosphate aldolase; FBP aldolase; FBPA; Fructose-1,6-bisphosphate aldolase; EC 4.1.2.13 from Bacillus subtilis (strain 168) (see paper)
26% identity, 91% coverage: 18:342/359 of query aligns to 6:268/285 of P13243
4to8A Methicillin-resistant staphylococcus aureus class iib fructose 1,6- bisphosphate aldolase (see paper)
24% identity, 92% coverage: 25:353/359 of query aligns to 12:271/279 of 4to8A
3q94A The crystal structure of fructose 1,6-bisphosphate aldolase from bacillus anthracis str. 'Ames ancestor'
26% identity, 89% coverage: 18:335/359 of query aligns to 6:261/285 of 3q94A
>BWI76_RS23975 FitnessBrowser__Koxy:BWI76_RS23975
MSKIFDFVKPGVITGDDVQKVFQVAKENQFALPAVNCVGTDSINAVLEAAAKVRSPVIVQ
FSNGGAAFIAGKGVKTDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWI
DGLLDAGEKHFAATGKPLFSSHMIDLSEESLHENIEICSKYLARMAKMDMTLEIELGCTG
GEEDGVDNSHMDASALYTQPEDVDYAYTELSKISPRFTIAASFGNVHGVYKPGNVVLTPT
ILRDSQEYVSKKHNLPHNSLNFVFHGGSGSSAQEIKDSVSYGVIKMNIDTDTQWATWDGI
LQYYKTNEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAAQTSMVTRLEQAFKELNAIDVL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory