Comparing BWI76_RS24030 FitnessBrowser__Koxy:BWI76_RS24030 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
3nzqA Crystal structure of biosynthetic arginine decarboxylase adc (spea) from escherichia coli, northeast structural genomics consortium target er600 (see paper)
95% identity, 95% coverage: 34:658/658 of query aligns to 1:625/628 of 3nzqA
3n2oA X-ray crystal structure of arginine decarboxylase complexed with arginine from vibrio vulnificus (see paper)
54% identity, 94% coverage: 39:657/658 of query aligns to 9:630/630 of 3n2oA
3n2oB X-ray crystal structure of arginine decarboxylase complexed with arginine from vibrio vulnificus (see paper)
54% identity, 94% coverage: 39:657/658 of query aligns to 8:629/629 of 3n2oB
Q9SI64 Arginine decarboxylase 1, chloroplastic; ADC 1; ADC-O; ARGDC 1; AtADC1; EC 4.1.1.19 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 89% coverage: 39:625/658 of query aligns to 43:623/702 of Q9SI64
3nzpB Crystal structure of the biosynthetic arginine decarboxylase spea from campylobacter jejuni, northeast structural genomics consortium target br53 (see paper)
33% identity, 90% coverage: 39:633/658 of query aligns to 4:555/591 of 3nzpB
Sites not aligning to the query:
3c5qA Crystal structure of diaminopimelate decarboxylase (i148l mutant) from helicobacter pylori complexed with l-lysine
25% identity, 43% coverage: 102:383/658 of query aligns to 20:280/394 of 3c5qA
Sites not aligning to the query:
B4XMC6 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Helicobacter pylori (Campylobacter pylori) (see paper)
25% identity, 42% coverage: 102:377/658 of query aligns to 22:276/405 of B4XMC6
Sites not aligning to the query:
4xg1B Psychromonas ingrahamii diaminopimelate decarboxylase with llp
25% identity, 46% coverage: 120:420/658 of query aligns to 53:338/418 of 4xg1B
Sites not aligning to the query:
7ru7A Crystal structure of btrk, a decarboxylase involved in butirosin biosynthesis
26% identity, 35% coverage: 145:377/658 of query aligns to 65:286/412 of 7ru7A
Sites not aligning to the query:
5x7mA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
26% identity, 36% coverage: 143:376/658 of query aligns to 87:313/443 of 5x7mA
Sites not aligning to the query:
5x7nA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
26% identity, 36% coverage: 143:376/658 of query aligns to 87:313/442 of 5x7nA
Sites not aligning to the query:
1twiA Crystal structure of diaminopimelate decarboxylase from m. Jannaschii in co-complex with l-lysine (see paper)
23% identity, 46% coverage: 106:405/658 of query aligns to 50:336/434 of 1twiA
Sites not aligning to the query:
1tufA Crystal structure of diaminopimelate decarboxylase from m. Jannaschi (see paper)
23% identity, 46% coverage: 106:405/658 of query aligns to 50:336/434 of 1tufA
Q58497 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
23% identity, 46% coverage: 106:405/658 of query aligns to 54:340/438 of Q58497
Sites not aligning to the query:
4xg1A Psychromonas ingrahamii diaminopimelate decarboxylase with llp
24% identity, 48% coverage: 105:420/658 of query aligns to 33:313/393 of 4xg1A
Sites not aligning to the query:
1hkvA Mycobacterium diaminopimelate dicarboxylase (lysa) (see paper)
27% identity, 35% coverage: 141:371/658 of query aligns to 83:310/446 of 1hkvA
Sites not aligning to the query:
P9WIU7 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
27% identity, 35% coverage: 141:371/658 of query aligns to 84:311/447 of P9WIU7
Sites not aligning to the query:
6n2aA Meso-diaminopimelate decarboxylase from arabidopsis thaliana (isoform 1)
22% identity, 39% coverage: 124:382/658 of query aligns to 60:300/422 of 6n2aA
Sites not aligning to the query:
5gjoA Crystal structure of srldc mutant (a225c/t302c) in complex with plp (see paper)
27% identity, 21% coverage: 241:380/658 of query aligns to 151:276/385 of 5gjoA
Sites not aligning to the query:
>BWI76_RS24030 FitnessBrowser__Koxy:BWI76_RS24030
MSDDMSLSSPSSAGDHGVLRSMQEVAMSSQEASKMLRTYNIAWWGNNYYDVNELGHISVC
PDPDVPEARVDLAELVKAREAQGQRLPALFCFPQILQHRLRSINAAFKRARESYGYNGDY
FLVYPIKVNQHRRVIESLIHSGEPLGLEAGSKAELMAVLAHAGMTRSVIVCNGYKDREYI
RLALVGEKMGHKVYLVIEKMSEIAIVLEEAERLNVVPRLGVRARLASQGSGKWQSSGGEK
SKFGLAATQVLQLVEILRSAGHLDSLQLLHFHLGSQMANIRDIATGVRESSRFYVELHKL
GVNIQCFDVGGGLGVDYEGTRSQSDCSVNYGLNEYANNIIWAIGDACEENGLPHPTVITE
SGRAVTAHHTVLVSNIIGVERNEYTEATPPAEDAARPLQSMWETWLEMQETGNRRSLREW
LHDSQMDLHDIHIGYSSGTFNLQERAWAEQLYLNMCHEVQKQLDPSNRAHRPIIDELQER
MADKIYVNFSLFQSMPDAWGIDQLFPVMPLEGLNMVPERRAVLLDITCDSDGAIDHYVDG
DGIATTMPMPEYDPENPPMLGFFMVGAYQEILGNMHNLFGDTEAVDVFVFPDGSVEVELS
DEGDTVADMLQYVQLDPNTLLTQFRDQVKNTDLDAALQQQFLEEFEAGLYGYTYLEDE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory