Comparing BWI76_RS24175 FitnessBrowser__Koxy:BWI76_RS24175 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
1ordA Crystallographic structure of a plp-dependent ornithine decarboxylase from lactobacillus 30a to 3.1 angstroms resolution (see paper)
54% identity, 100% coverage: 3:712/712 of query aligns to 3:719/730 of 1ordA
1c4kA Ornithine decarboxylase mutant (gly121tyr) (see paper)
55% identity, 100% coverage: 3:712/712 of query aligns to 3:717/728 of 1c4kA
6q6iA Lysine decarboxylase a from pseudomonas aeruginosa
36% identity, 86% coverage: 91:701/712 of query aligns to 138:740/749 of 6q6iA
2vycA Crystal structure of acid induced arginine decarboxylase from e. Coli (see paper)
34% identity, 85% coverage: 90:693/712 of query aligns to 129:741/755 of 2vycA
P28629 Biodegradative arginine decarboxylase; ADC; EC 4.1.1.19 from Escherichia coli (strain K12) (see paper)
34% identity, 85% coverage: 90:693/712 of query aligns to 129:741/755 of P28629
6q7lA Inducible lysine decarboxylase (see paper)
36% identity, 85% coverage: 95:698/712 of query aligns to 124:701/711 of 6q7lA
3n75A X-ray crystal structure of the escherichia coli inducible lysine decarboxylase ldci (see paper)
36% identity, 85% coverage: 95:698/712 of query aligns to 124:701/711 of 3n75A
Sites not aligning to the query:
5xx1G Crystal structure of arginine decarboxylase (adia) from salmonella typhimurium (see paper)
32% identity, 85% coverage: 90:693/712 of query aligns to 130:721/735 of 5xx1G
>BWI76_RS24175 FitnessBrowser__Koxy:BWI76_RS24175
MKSMHIAASRELVSRLSTHRRVVALDSTDFTDVAAVVITVADSRSGILALLKRTGFNLPV
YLFSEADHEKPQGVMAIVSGKEQEWLELEAAACGYEENLLPPFFDTLTQYVEMDNSTFAC
PGHQHGAFFKKHPAGRQFFDFFGENVFRADMCNADVKLGDLLIHEGSAKHAQKFAAKVFN
ADKTYFVLNGTSAANKVVTNALLTRGDLVLFDRNNHKSNHHGALIQAGATPVYLEASRNP
FGFIGGIDDRCFDEKYLRDLIRETAPEKADMPRPFRLAVIQLGTYDGTVYNARQVVDKIG
SLCDYILFDSAWVGYEQFIPMMADCSPLLLDLTPDDPGIFVTQSVHKQQAGFSQTSQIHK
KDNHLRGQERFCPHKRLNNAFMLHASTSPFYPLFAALDVNAKIHEGESGRRLWAECVALG
IEARKAIIANCKMIQPFIPPVVAGRPWQDHPTEAIARERRFFSFEPGARWHGFEGYASDQ
YFVDPCKLLLTTPGIDAESGKYTDFGIPATILAHYLRENGIVPEKCDLNSILFLLTPAES
AEKLAQLVAMLARFEQHIESDTPLADVLPTIFNKYPVRYRDYTIRELCQEMHNLYVSFDV
KDLQKEMFRKKSFPRAVMNPQDANREFIRGNVELVRLSAAEGRIAAEGALPYPPGVLCVV
PGEIWGGAVLRYFLALEEGVNMLPGFSPELQGVYSETDPDGIKRLYGYVLKA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory