Comparing BWI76_RS24605 FitnessBrowser__Koxy:BWI76_RS24605 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
P37349 PEP-dependent dihydroxyacetone kinase, phosphoryl donor subunit DhaM; Dihydroxyacetone kinase subunit M; EC 2.7.1.121 from Escherichia coli (strain K12) (see paper)
65% identity, 100% coverage: 1:472/473 of query aligns to 1:470/472 of P37349
P23533 Phosphoenolpyruvate-protein phosphotransferase; Phosphotransferase system, enzyme I; EC 2.7.3.9 from Staphylococcus carnosus (strain TM300) (see paper)
27% identity, 38% coverage: 286:464/473 of query aligns to 43:222/573 of P23533
Sites not aligning to the query:
2wqdA Crystal structure of enzyme i of the phosphoenolpyruvate:sugar phosphotransferase system in the dephosphorylated state (see paper)
26% identity, 40% coverage: 275:464/473 of query aligns to 32:222/570 of 2wqdA
Sites not aligning to the query:
P08839 Phosphoenolpyruvate-protein phosphotransferase; Phosphotransferase system, enzyme I; EC 2.7.3.9 from Escherichia coli (strain K12) (see 2 papers)
27% identity, 45% coverage: 260:470/473 of query aligns to 14:227/575 of P08839
Sites not aligning to the query:
2hwgA Structure of phosphorylated enzyme i of the phosphoenolpyruvate:sugar phosphotransferase system (see paper)
27% identity, 45% coverage: 260:470/473 of query aligns to 13:226/572 of 2hwgA
Sites not aligning to the query:
O69250 Phosphocarrier protein HPr; Histidine-containing protein from Priestia megaterium (Bacillus megaterium) (see 2 papers)
33% identity, 18% coverage: 160:242/473 of query aligns to 5:88/88 of O69250
Q9F166 Phosphocarrier protein HPr from Bacillus thuringiensis subsp. israelensis (see 2 papers)
35% identity, 17% coverage: 163:242/473 of query aligns to 7:87/87 of Q9F166
1pohA The 2.0 angstroms resolution structure of escherichia coli histidine- containing phosphocarrier protein hpr: a redetermination (see paper)
32% identity, 16% coverage: 161:238/473 of query aligns to 6:83/85 of 1pohA
1j6tB Complex of enzyme iiamtl and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure (see paper)
32% identity, 16% coverage: 161:238/473 of query aligns to 6:83/85 of 1j6tB
P0AA04 Phosphocarrier protein HPr; Histidine-containing protein from Escherichia coli (strain K12) (see paper)
32% identity, 16% coverage: 161:238/473 of query aligns to 6:83/85 of P0AA04
>BWI76_RS24605 FitnessBrowser__Koxy:BWI76_RS24605
MVNLVIVSHSARLGEGVGELARQMLMNDGCKLAIAAGIDDPASPIGTDPIKVMEAIESVA
DADHVLVMMDIGSALLSAETALDLLDPAIAAKVRLCAAPLVEGTLAATVSAAAGADIDKV
IEDAMNALEAKRVQLGLPSQPQPPSLTAELADDRDARSVSVVIQNPNGLHVRPASKLVAA
LAGFNADLVLEKEGKCVTPDSLNQIALLQVRRNDTLRLLARGPDADAALAAFQALAAENF
GEQTEATPALQPTHAARIQGQVVLYPRPQNSVTREKSAAIGQQQLRLKRAIDRTLDDLSA
LTALAEEKYSADIAAIFSGHHTLLDDPDLYTAACDIVRDEQCSAEWAWHQVLSDLSQQYR
HLDDAYLQARYIDIEDILHRTLRHLNESSEALPQFSTPSILVADDIFPSTVVQLDGRQVK
GICLQESSEHAHGAIIARQAGIAMLCQQRDVLTTLQNGETVTLDIPGKRVIRG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory