Comparing BWI76_RS24610 BWI76_RS24610 dihydroxyacetone kinase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
P45510 Dihydroxyacetone kinase; DHA kinase; Glycerone kinase; EC 2.7.1.29 from Citrobacter freundii (see 2 papers)
84% identity, 100% coverage: 1:548/549 of query aligns to 1:548/552 of P45510
1un9A Crystal structure of the dihydroxyacetone kinase from c. Freundii in complex with amp-pnp and mg2+ (see paper)
82% identity, 100% coverage: 2:548/549 of query aligns to 2:535/537 of 1un9A
Q3LXA3 Triokinase/FMN cyclase; Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing); EC 2.7.1.28; EC 2.7.1.29; EC 4.6.1.15 from Homo sapiens (Human) (see 4 papers)
40% identity, 97% coverage: 2:535/549 of query aligns to 3:558/575 of Q3LXA3
Q9CIV8 PTS-dependent dihydroxyacetone kinase, dihydroxyacetone-binding subunit DhaK; EC 2.7.1.121 from Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) (see paper)
35% identity, 59% coverage: 5:327/549 of query aligns to 6:331/332 of Q9CIV8
3ct4A Structure of dha-kinase subunit dhak from l. Lactis (see paper)
36% identity, 59% coverage: 5:327/549 of query aligns to 3:318/318 of 3ct4A
P76015 PEP-dependent dihydroxyacetone kinase, dihydroxyacetone-binding subunit DhaK; EC 2.7.1.121 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 55% coverage: 32:332/549 of query aligns to 28:348/356 of P76015
1uodA Crystal structure of the dihydroxyacetone kinase from e. Coli in complex with dihydroxyacetone-phosphate (see paper)
32% identity, 55% coverage: 32:332/549 of query aligns to 19:328/336 of 1uodA
1uoeA Crystal structure of the dihydroxyacetone kinase from e. Coli in complex with glyceraldehyde (see paper)
32% identity, 55% coverage: 32:332/549 of query aligns to 19:328/336 of 1uoeA
3pnqD Crystal structure of e.Coli dha kinase dhak (h56n) complex with dha (see paper)
32% identity, 55% coverage: 32:332/549 of query aligns to 19:326/334 of 3pnqD
Q9CIV7 PTS-dependent dihydroxyacetone kinase, ADP-binding subunit DhaL; EC 2.7.1.121 from Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) (see paper)
29% identity, 34% coverage: 360:548/549 of query aligns to 9:189/192 of Q9CIV7
3cr3A Structure of a transient complex between dha-kinase subunits dham and dhal from lactococcus lactis (see paper)
29% identity, 34% coverage: 360:548/549 of query aligns to 9:189/192 of 3cr3A
P76014 PEP-dependent dihydroxyacetone kinase, ADP-binding subunit DhaL; EC 2.7.1.121 from Escherichia coli (strain K12) (see 3 papers)
28% identity, 35% coverage: 358:547/549 of query aligns to 8:205/210 of P76014
4lrzA Crystal structure of the e.Coli dhar(n)-dhal complex (see paper)
28% identity, 35% coverage: 358:547/549 of query aligns to 9:206/211 of 4lrzA
>BWI76_RS24610 BWI76_RS24610 dihydroxyacetone kinase
MSQFFFNQRANLVNDVIEGTIIASPWNNLARLESDPAIRVVVRRDLDKNNVAVISGGGSG
HEPAHAGFVGKGMLTAAVCGDLFASPSVDAVLTAIQAVTGDAGCLLIVKNYTGDRLNFGL
AAEKARRMGYNVEMLIVGDDISLPDNKHPRGIAGTILVHKVAGYFAERGHNLATVLREAQ
YAAGHTFSLGLALASCHLPQDAETAPRHHADQAELGMGIHGEPGASVIATQNSAEIVTLM
AEKLSAALPETGRLAVMINNLGGVSIAEMAILTRELAHTPLQQRIDWLIGPASLVTALDM
KGFSLTAIVLEESIEKALLSAVETAGWQTPVQPREISVMPSSLRSTRVEFEPSENSVVAD
YVERVTGTLSDLEADLNALDAKVGDGDTGSTFAAGARDIADLLQRRQLPLANLATLLALI
GERLTVVMGGSSGVLMSIFFTAAGQKLEQGASVAEALNAGLAQMKFYGGADEGDRTMIDA
LQPALAALAAEPENLQAAFAAAQAGADRTLHASKANAGRASYLNSDSLRGNMDPGAHAVA
MVFKALAQK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory