SitesBLAST
Comparing BWI76_RS24825 BWI76_RS24825 2-hydroxy-3-oxopropionate reductase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3w6zA Crystal structure of NADP bound l-serine 3-dehydrogenase (k170m) from hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
39% identity, 96% coverage: 3:285/296 of query aligns to 14:296/296 of 3w6zA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G9), L21 (= L10), G22 (= G11), I23 (= I12), M24 (= M13), N43 (≠ D32), R44 (= R33), T45 (≠ N34), K48 (≠ A37), V77 (≠ L66), S78 (≠ P67), D82 (≠ H71), Q85 (≠ E74), V133 (= V122), F244 (= F233), K245 (≠ R234), H248 (≠ L237), K251 (= K240)
3ws7A The 1.18 a resolution structure of l-serine 3-dehydrogenase complexed with NADP+ and sulfate ion from the hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
39% identity, 96% coverage: 3:285/296 of query aligns to 14:293/293 of 3ws7A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G9), L21 (= L10), G22 (= G11), I23 (= I12), M24 (= M13), N43 (≠ D32), R44 (= R33), T45 (≠ N34), K48 (≠ A37), M76 (= M65), V77 (≠ L66), S78 (≠ P67), D82 (≠ H71), Q85 (≠ E74), V133 (= V122), F241 (= F233), K242 (≠ R234), H245 (≠ L237), K248 (= K240)
- binding sulfate ion: T134 (≠ S123), G135 (= G124), K183 (= K172)
3pefA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with NADP+ (see paper)
37% identity, 97% coverage: 2:288/296 of query aligns to 1:287/287 of 3pefA
- binding glycerol: D67 (≠ N68), G123 (= G124), K171 (= K172), N175 (≠ Q176), M178 (≠ V179), L203 (≠ Y204), G207 (≠ R208), N213 (≠ S214), A217 (≠ D218), F232 (= F233), H236 (≠ L237), K239 (= K240), R242 (≠ A243), R269 (= R270)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G11), I11 (= I12), M12 (= M13), N31 (≠ D32), R32 (= R33), S33 (≠ N34), K36 (≠ A37), M64 (= M65), L65 (= L66), A66 (≠ P67), A70 (≠ H71), E73 (= E74), T96 (≠ S97), V121 (= V122), G123 (= G124), S124 (≠ G125), A231 (≠ G232), F232 (= F233), H236 (≠ L237), K239 (= K240)
5je8B The crystal structure of bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with NAD (see paper)
35% identity, 97% coverage: 4:291/296 of query aligns to 5:291/294 of 5je8B
2i9pB Crystal structure of human hydroxyisobutyrate dehydrogenase complexed with NAD+
36% identity, 95% coverage: 3:282/296 of query aligns to 1:287/296 of 2i9pB
- binding nicotinamide-adenine-dinucleotide: G9 (= G11), N10 (≠ I12), M11 (= M13), Y29 (≠ A31), D30 (= D32), V31 (≠ R33), M63 (= M65), L64 (= L66), P65 (= P67), T95 (≠ S97), V120 (= V122), G122 (= G124), F238 (= F233), K245 (= K240)
P29266 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Rattus norvegicus (Rat) (see paper)
36% identity, 95% coverage: 5:285/296 of query aligns to 41:328/335 of P29266
- D68 (= D32) mutation to R: Decrease of activity with NAD, increase of activity with NADP.
- K208 (= K172) mutation K->A,H,N,R: Complete loss of activity.
- N212 (≠ Q176) mutation to Q: Decrease in activity.
P31937 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Homo sapiens (Human) (see paper)
36% identity, 94% coverage: 5:282/296 of query aligns to 42:326/336 of P31937
- LP 103:104 (= LP 66:67) binding
- N108 (≠ H71) binding
- T134 (≠ S97) binding
- K284 (= K240) binding
Sites not aligning to the query:
- 1:36 modified: transit peptide, Mitochondrion
- 40:68 binding
6smzC Crystal structure of sla reductase yihu from e. Coli in complex with nadh
37% identity, 94% coverage: 5:282/296 of query aligns to 3:281/295 of 6smzC
- binding nicotinamide-adenine-dinucleotide: G9 (= G11), Q10 (≠ I12), M11 (= M13), F29 (≠ A31), D30 (= D32), V31 (≠ R33), M63 (= M65), L64 (= L66), V73 (= V75), S94 (= S96), T95 (≠ S97), R122 (≠ G124)
6smyA Crystal structure of sla reductase yihu from e. Coli with nadh and product dhps
37% identity, 94% coverage: 5:282/296 of query aligns to 3:281/294 of 6smyA
P0A9V8 3-sulfolactaldehyde reductase; SLA reductase; 4-hydroxybutyrate dehydrogenase; Gamma-hydroxybutyrate dehydrogenase; GHBDH; Succinic semialdehyde reductase; SSA reductase; EC 1.1.1.373; EC 1.1.1.61 from Escherichia coli (strain K12)
37% identity, 94% coverage: 5:282/296 of query aligns to 4:282/298 of P0A9V8
- QM 11:12 (≠ IM 12:13) binding
- D31 (= D32) binding
- L65 (= L66) binding
- T96 (≠ S97) binding
- G122 (≠ S123) mutation to S: 25-fold decrease in catalytic efficiency with SLA as substrate. 5-fold decrease in catalytic efficiency with NADH as substrate.
- R123 (≠ G124) binding ; mutation to G: 130-fold decrease in catalytic efficiency with SLA as substrate. 3-fold decrease in catalytic efficiency with NADH as substrate.
- T124 (≠ G125) mutation to G: 230-fold decrease in catalytic efficiency with SLA as substrate. 12-fold decrease in catalytic efficiency with NADH as substrate.
- NNYMS 174:178 (≠ NQVI- 175:178) binding
- K240 (= K240) binding
3pduA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with NADP+ (see paper)
32% identity, 94% coverage: 6:282/296 of query aligns to 5:281/287 of 3pduA
- binding glycerol: R242 (≠ A243), E246 (≠ D247), E246 (≠ D247), R250 (≠ G251)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G9), G10 (= G11), I11 (= I12), M12 (= M13), N31 (≠ D32), R32 (= R33), N33 (= N34), M64 (= M65), L65 (= L66), A66 (≠ P67), A70 (≠ H71), T96 (≠ S97), V121 (= V122), G123 (= G124), T124 (≠ G125), K171 (= K172), S231 (≠ G232), F232 (= F233), P233 (≠ R234), H236 (≠ L237), K239 (= K240)
2uyyA Structure of the cytokine-like nuclear factor n-pac
29% identity, 95% coverage: 4:285/296 of query aligns to 8:287/292 of 2uyyA
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4s)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: G15 (= G11), L16 (≠ I12), M17 (= M13), N36 (≠ D32), R37 (= R33), T38 (≠ N34), V70 (≠ L66), S71 (≠ P67), A75 (≠ H71), T101 (≠ S97), F237 (= F233), Y238 (≠ R234), Y241 (≠ L237), K244 (= K240)
Q9I5I6 NAD-dependent L-serine dehydrogenase; L-serine 3-dehydrogenase (NAD(+)); EC 1.1.1.387 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
39% identity, 81% coverage: 4:242/296 of query aligns to 3:248/298 of Q9I5I6
- P66 (= P67) binding
- T96 (≠ S97) binding ; mutation to A: Almost abolished activity.
- S122 (= S123) mutation to A: Strongly reduced activity.
- K171 (= K172) active site
- N175 (≠ Q176) mutation to A: Strongly reduced activity.
- W214 (≠ T215) mutation to A: Almost abolished activity.
- Y219 (≠ K220) mutation to A: Strongly reduced activity.
- K246 (= K240) binding ; mutation to A: Almost abolished activity.
- D247 (= D241) mutation to A: Almost abolished activity.
Sites not aligning to the query:
Q49A26 Cytokine-like nuclear factor N-PAC; NPAC; 3-hydroxyisobutyrate dehydrogenase-like protein; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Nuclear protein of 60 kDa; Nucleosome-destabilizing factor; hNDF; Putative oxidoreductase GLYR1 from Homo sapiens (Human) (see 3 papers)
29% identity, 95% coverage: 4:285/296 of query aligns to 269:548/553 of Q49A26
- 271:285 (vs. 6:20, 53% identical) binding
- T362 (≠ S97) binding
- M437 (≠ K172) mutation to K: Loss of tetramerization and protein stability.; mutation to N: No effect on tetramerization or protein stability.
- P496 (= P231) to L: decreased interaction with GATA4; decreased synergistic activation of GATA4 target genes transcription; detrimental effect on cardiomyocyte differentiation
- K505 (= K240) binding
Sites not aligning to the query:
- 214 D→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 214:217 Interaction with histone H3
- 216 H→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 216:225 Interaction with KDM1B
- 217 Required to promote KDM1B demethylase activity toward histone H3K4me1 and H3K4me2; F→A: Abolished stimulation of KDM1B demethylase activity, reduced affinity for histone H3 of the dimer with KDM1B, but normal KDM1B-binding.
- 219 H→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-223.
- 220:222 FLL→AAA: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity.
- 223 S→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-219.
3q3cA Crystal structure of a serine dehydrogenase from pseudomonas aeruginosa pao1 in complex with NAD (see paper)
39% identity, 81% coverage: 4:242/296 of query aligns to 2:246/294 of 3q3cA
- binding nicotinamide-adenine-dinucleotide: G9 (= G11), H10 (≠ I12), M11 (= M13), F29 (≠ A31), D30 (= D32), L31 (≠ R33), M63 (= M65), L64 (= L66), P65 (= P67), T94 (≠ S97), V119 (= V122), G121 (= G124), F237 (= F233), K244 (= K240)
3obbA Crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from pseudomonas aeruginosa pao1 (see paper)
39% identity, 81% coverage: 4:242/296 of query aligns to 3:247/295 of 3obbA
Q922P9 Cytokine-like nuclear factor N-PAC; NPAC; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Putative oxidoreductase GLYR1 from Mus musculus (Mouse) (see paper)
29% identity, 95% coverage: 4:285/296 of query aligns to 268:541/546 of Q922P9
- P489 (= P231) mutation to L: Mutant animals are born at expected Mendelian ratios. 54% mutants display postnatal lethality between days 0 and 1. They show centricular septal defects.
5y8iA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + (s)-3-hydroxyisobutyrate (s-hiba) (see paper)
34% identity, 91% coverage: 5:272/296 of query aligns to 3:274/292 of 5y8iA
5y8hA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + NAD+ (see paper)
34% identity, 91% coverage: 5:272/296 of query aligns to 3:274/291 of 5y8hA
- binding (2~{S})-2-methylpentanedioic acid: R144 (≠ Y149), E148 (≠ K153), A151 (= A156), K153 (≠ S158)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G9 (= G11), N10 (≠ I12), M11 (= M13), F29 (≠ A31), D30 (= D32), P31 (≠ R33), M63 (= M65), L64 (= L66), G120 (= G125), L239 (= L237), K242 (= K240)
5y8lB Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + NAD +(s)-3-hydroxyisobutyrate (s-hiba) (see paper)
34% identity, 91% coverage: 5:272/296 of query aligns to 4:275/290 of 5y8lB
- binding (2~{S})-2-methylpentanedioic acid: T129 (= T133), E149 (≠ K153), A152 (= A156), G153 (= G157), G153 (= G157), K154 (≠ S158)
- binding (2S)-2-methyl-3-oxidanyl-propanoic acid: S119 (= S123), G120 (= G124), W211 (≠ T215), F236 (= F233)
- binding nicotinamide-adenine-dinucleotide: G8 (= G9), G10 (= G11), N11 (≠ I12), M12 (= M13), F30 (≠ A31), D31 (= D32), P32 (≠ R33), M64 (= M65), L65 (= L66), T93 (≠ S97), G121 (= G125), K168 (= K172), L240 (= L237), K243 (= K240)
Query Sequence
>BWI76_RS24825 BWI76_RS24825 2-hydroxy-3-oxopropionate reductase
MTMKVGFIGLGIMGKPMSKNLLKAGYSLVVADRNPEAIAEVIAAGAETAASAKAIAEQCD
VIITMLPNSPHVKEVALGEGGIIEGAKPGTVLIDMSSIAPLASREISEALKAKGVDMLDA
PVSGGEPKAIDGTLSVMVGGDKAIFDKYYELLKAMAGSVVHTGEIGAGNVTKLANQVIVA
LNIAAMSEALTLATKAGVNPDLVYQAIRGGLAGSTVLDAKAPMVMDRNFKPGFRIDLHIK
DLANALDTSHGVGAQLPLTAAVMEMMQALRADGLGTADHSALACYYEKLAKVEVTR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory