Comparing BWI76_RS24870 FitnessBrowser__Koxy:BWI76_RS24870 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
1j6tA Complex of enzyme iiamtl and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure (see paper)
42% identity, 52% coverage: 1:140/271 of query aligns to 2:143/144 of 1j6tA
P00550 PTS system mannitol-specific EIICBA component; EIICBA-Mtl; EII-Mtl; EC 2.7.1.197 from Escherichia coli (strain K12) (see 2 papers)
42% identity, 52% coverage: 1:140/271 of query aligns to 494:635/637 of P00550
Sites not aligning to the query:
C0H3V2 Mannitol-specific phosphotransferase enzyme IIA component; EIIA; EIII; PTS system mannitol-specific EIIA component from Bacillus subtilis (strain 168) (see paper)
35% identity, 50% coverage: 3:138/271 of query aligns to 4:139/143 of C0H3V2
Q9F166 Phosphocarrier protein HPr from Bacillus thuringiensis subsp. israelensis (see 2 papers)
40% identity, 32% coverage: 159:246/271 of query aligns to 2:87/87 of Q9F166
O69250 Phosphocarrier protein HPr; Histidine-containing protein from Priestia megaterium (Bacillus megaterium) (see 2 papers)
39% identity, 32% coverage: 161:246/271 of query aligns to 5:88/88 of O69250
1pohA The 2.0 angstroms resolution structure of escherichia coli histidine- containing phosphocarrier protein hpr: a redetermination (see paper)
40% identity, 30% coverage: 155:234/271 of query aligns to 1:75/85 of 1pohA
1j6tB Complex of enzyme iiamtl and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure (see paper)
40% identity, 30% coverage: 155:234/271 of query aligns to 1:75/85 of 1j6tB
P0AA04 Phosphocarrier protein HPr; Histidine-containing protein from Escherichia coli (strain K12) (see paper)
40% identity, 30% coverage: 155:234/271 of query aligns to 1:75/85 of P0AA04
P08877 Phosphocarrier protein HPr; Histidine-containing protein from Bacillus subtilis (strain 168) (see 5 papers)
36% identity, 32% coverage: 159:246/271 of query aligns to 3:88/88 of P08877
Sites not aligning to the query:
Q84F84 Phosphocarrier protein HPr; Histidine-containing protein from Lysinibacillus sphaericus (Bacillus sphaericus) (see paper)
36% identity, 28% coverage: 162:238/271 of query aligns to 6:79/88 of Q84F84
P24366 Phosphocarrier protein HPr; Histidine-containing protein from Streptococcus salivarius (see paper)
37% identity, 28% coverage: 162:236/271 of query aligns to 6:77/87 of P24366
O31645 PTS system mannose-specific EIIBCA component; EIIBCA-Man; EII-Man; EC 2.7.1.191 from Bacillus subtilis (strain 168) (see 2 papers)
27% identity, 46% coverage: 15:138/271 of query aligns to 518:646/650 of O31645
Sites not aligning to the query:
Q9CJ83 Phosphocarrier protein HPr; Histidine-containing protein from Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) (see paper)
37% identity, 29% coverage: 169:246/271 of query aligns to 13:88/88 of Q9CJ83
Q9WXK8 Phosphocarrier protein HPr; Histidine-containing protein from Streptococcus equinus (Streptococcus bovis) (see paper)
35% identity, 24% coverage: 162:226/271 of query aligns to 6:67/87 of Q9WXK8
>BWI76_RS24870 FitnessBrowser__Koxy:BWI76_RS24870
MQLSCADIHFDREIKTKDEALQRVVGRLTEAGHTTAAYLNGMRDREGQISTYLGNGIAIP
HGTPQSRDAVLKTGVKVLACPQGVDWGEQQTAYLIVGIAAQDSEHLDILRQLTHAMSDER
VPEALSRTESPQAVLEILAGNIFPAEGEDMEPPPVFDEEATFTLRNPHGLHARPSAVLVK
AVKQWRSQIRVENLDTRSAIVDAKNLMRVVSLGAKQGHRLHFMASGEDAHQALEAIGTAF
NAGLGEIAAQPQQVVQPAEKPKRSWLSRIFS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory