Comparing BWI76_RS25335 FitnessBrowser__Koxy:BWI76_RS25335 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4qq7A Crystal structure of putative stringent starvation protein a from burkholderia cenocepacia with bound glutathione
44% identity, 94% coverage: 9:208/212 of query aligns to 1:203/204 of 4qq7A
4hojA Crystal structure of glutathione transferase homolog from neisseria gonorrhoeae, target efi-501841, with bound glutathione
45% identity, 93% coverage: 11:208/212 of query aligns to 1:196/197 of 4hojA
6wegD Structure of ft (mgla-sspa)-ppgpp-pigr peptide complex (see paper)
31% identity, 88% coverage: 9:195/212 of query aligns to 2:188/194 of 6wegD
6wmtS F. Tularensis rnaps70-(mgla-sspa)-ppgpp-pigr-igla DNA complex (see paper)
32% identity, 87% coverage: 11:195/212 of query aligns to 3:187/202 of 6wmtS
5j4uA Crystal structure of a glutathione s-transferase ptgstu30 from populus trichocarpa in complex with gsh
27% identity, 87% coverage: 21:205/212 of query aligns to 14:203/218 of 5j4uA
Sites not aligning to the query:
5agyA Crystal structure of a tau class gst mutant from glycine (see paper)
26% identity, 87% coverage: 21:205/212 of query aligns to 15:204/219 of 5agyA
Sites not aligning to the query:
4topA Glycine max glutathione transferase
26% identity, 87% coverage: 21:205/212 of query aligns to 14:203/218 of 4topA
Sites not aligning to the query:
5g5aA Glutathione transferase u25 from arabidopsis thaliana in complex with glutathione disulfide
26% identity, 90% coverage: 20:209/212 of query aligns to 13:207/219 of 5g5aA
Sites not aligning to the query:
Q8L7C9 Glutathione S-transferase U20; AtGSTU20; FIN219-interacting protein 1; GST class-tau member 20; EC 2.5.1.18 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
24% identity, 88% coverage: 20:205/212 of query aligns to 14:204/217 of Q8L7C9
Sites not aligning to the query:
5echB Crystal structure of fin219-fip1 complex with ja and atp (see paper)
24% identity, 88% coverage: 20:205/212 of query aligns to 11:201/214 of 5echB
Sites not aligning to the query:
4chsA Crystal structure of a tau class glutathione transferase 10 from glycine max (see paper)
28% identity, 68% coverage: 21:164/212 of query aligns to 14:159/215 of 4chsA
6srbB Crystal structure of glutathione transferase omega 3c from trametes versicolor (see paper)
27% identity, 92% coverage: 11:205/212 of query aligns to 19:218/233 of 6srbB
Sites not aligning to the query:
6ep7B Arabidopsis thaliana gstu23, gsh bound (see paper)
28% identity, 66% coverage: 20:158/212 of query aligns to 11:151/214 of 6ep7B
Sites not aligning to the query:
7y55A Crystal structure of a glutathione s-transferase tau1 from pinus densata in complex with gsh
26% identity, 75% coverage: 6:164/212 of query aligns to 2:165/224 of 7y55A
6pnoA Human gsto1-1 complexed with 2-chloro-n-(4-chloro-3-(n- isopropylsulfamoyl)phenyl)acetamide (see paper)
25% identity, 85% coverage: 21:201/212 of query aligns to 32:215/239 of 6pnoA
Sites not aligning to the query:
6pnmA Human gsto1-1 complexed with 2-chloro-n-(4-chloro-3- (morpholinosulfonyl)phenyl)acetamide (see paper)
25% identity, 85% coverage: 21:201/212 of query aligns to 32:215/239 of 6pnmA
Sites not aligning to the query:
5v3qA Human gsto1-1 complexed with ml175 (see paper)
25% identity, 85% coverage: 21:201/212 of query aligns to 32:215/239 of 5v3qA
Sites not aligning to the query:
5uehA Structure of gsto1 covalently conjugated to quinolinic acid fluorosulfate (see paper)
25% identity, 85% coverage: 21:201/212 of query aligns to 32:215/239 of 5uehA
Sites not aligning to the query:
4yqvA Glutathione s-transferase omega 1 bound to covalent inhibitor c4-10 (see paper)
24% identity, 89% coverage: 21:208/212 of query aligns to 30:219/237 of 4yqvA
Sites not aligning to the query:
4yqmA Glutathione s-transferase omega 1 bound to covalent inhibitor c1-27 (see paper)
24% identity, 89% coverage: 21:208/212 of query aligns to 30:219/237 of 4yqmA
Sites not aligning to the query:
>BWI76_RS25335 FitnessBrowser__Koxy:BWI76_RS25335
MAVAANKRSVMTLFSGPTDIYSHQVRIVLAEKGVSFEIEHVEKDNPPQDLIDLNPNQSVP
TLVDRELTLWESRIIMEYLDERFPHPPLMPVYPVARGESRLYMQRIEKDWYSLMNTIQTG
TAAQADTARKQLREELQAIAPVFTQKPYFLSDEFSLVDCYLAPLLWRLPVLGVELVGAGA
KELKGYMTRVFERDSFLASLTEAEREMRLGRG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory