Comparing BWI76_RS25645 FitnessBrowser__Koxy:BWI76_RS25645 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P15770 Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 from Escherichia coli (strain K12) (see paper)
79% identity, 100% coverage: 1:272/272 of query aligns to 1:272/272 of P15770
1nytA Shikimate dehydrogenase aroe complexed with NADP+ (see paper)
79% identity, 100% coverage: 1:271/272 of query aligns to 1:271/271 of 1nytA
Q9KVT3 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
50% identity, 100% coverage: 1:271/272 of query aligns to 5:275/278 of Q9KVT3
3pgjA 2.49 angstrom resolution crystal structure of shikimate 5- dehydrogenase (aroe) from vibrio cholerae o1 biovar eltor str. N16961 in complex with shikimate
50% identity, 100% coverage: 1:271/272 of query aligns to 1:271/272 of 3pgjA
P43876 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see paper)
49% identity, 99% coverage: 1:270/272 of query aligns to 1:271/272 of P43876
1p77A Crystal structure of shikimate dehydrogenase (aroe) from haemophilus influenzae (see paper)
48% identity, 99% coverage: 1:270/272 of query aligns to 1:264/265 of 1p77A
3sefA 2.4 angstrom resolution crystal structure of shikimate 5-dehydrogenase (aroe) from vibrio cholerae o1 biovar eltor str. N16961 in complex with shikimate and NADPH
50% identity, 100% coverage: 1:271/272 of query aligns to 1:267/268 of 3sefA
3sefC 2.4 angstrom resolution crystal structure of shikimate 5-dehydrogenase (aroe) from vibrio cholerae o1 biovar eltor str. N16961 in complex with shikimate and NADPH
47% identity, 100% coverage: 1:271/272 of query aligns to 1:244/244 of 3sefC
Q5HNV1 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Staphylococcus epidermidis (strain ATCC 35984 / RP62A) (see paper)
33% identity, 98% coverage: 4:270/272 of query aligns to 3:269/269 of Q5HNV1
3dooA Crystal structure of shikimate dehydrogenase from staphylococcus epidermidis complexed with shikimate (see paper)
33% identity, 94% coverage: 4:260/272 of query aligns to 3:246/258 of 3dooA
P56119 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
35% identity, 90% coverage: 1:246/272 of query aligns to 3:239/263 of P56119
3phiA Shikimate 5-dehydrogenase (aroe) from helicobacter pylori in complex with shikimate and NADPH
35% identity, 90% coverage: 1:246/272 of query aligns to 3:236/259 of 3phiA
2hk9B Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
33% identity, 93% coverage: 2:254/272 of query aligns to 7:252/267 of 2hk9B
4fosA Crystal structure of shikimate dehydrogenase (aroe) q237a mutant from helicobacter pylori in complex with shikimate
35% identity, 90% coverage: 1:246/272 of query aligns to 3:239/263 of 4fosA
2hk9A Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
33% identity, 93% coverage: 2:254/272 of query aligns to 7:252/269 of 2hk9A
O67049 Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 from Aquifex aeolicus (strain VF5) (see paper)
33% identity, 93% coverage: 2:254/272 of query aligns to 7:252/269 of O67049
3phjA Shikimate 5-dehydrogenase (aroe) from helicobacter pylori in complex with 3-dehydroshikimate
35% identity, 90% coverage: 1:246/272 of query aligns to 3:231/255 of 3phjA
2ev9B Crystal structure of shikimate 5-dehydrogenase (aroe) from thermus thermophilus hb8 in complex with NADP(h) and shikimate (see paper)
36% identity, 95% coverage: 1:258/272 of query aligns to 1:249/263 of 2ev9B
Q5SJF8 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
36% identity, 95% coverage: 1:258/272 of query aligns to 1:249/263 of Q5SJF8
2cy0A Crystal structure of shikimate 5-dehydrogenase (aroe) from thermus thermophilus hb8 in complex with NADP (see paper)
36% identity, 95% coverage: 1:258/272 of query aligns to 1:249/262 of 2cy0A
>BWI76_RS25645 FitnessBrowser__Koxy:BWI76_RS25645
METYAVFGNPIAHSKSPSIHRLFAQQLQITHPYGRILAPLDDFVTTLDAFFNEGGKGANV
TVPFKEEAFARADELTERAALAGAVNTLKRLEDGRLLGDNTDGIGLLSDLERLGFIKPGF
RVLLIGAGGASRGVLLPLLSLDCAVTIVNRTYSRAHELATLFSHTGSVRALDIEALGGQE
FDLIVNATSSGIDGDVPSIPVTLINPHVCCYDMFYQKGCTPFLALCQQHGATKCADGLGM
LVAQAAHAVLLWHGVLPEIRPVIAALQKELNA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory