Comparing BWI76_RS25955 FitnessBrowser__Koxy:BWI76_RS25955 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4s2uA Crystal structure of the phosphorybosylpyrophosphate synthetase from e. Coli
28% identity, 86% coverage: 17:265/289 of query aligns to 30:274/308 of 4s2uA
6asvC E. Coli prpp synthetase (see paper)
28% identity, 86% coverage: 17:265/289 of query aligns to 29:273/311 of 6asvC
P0A717 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Escherichia coli (strain K12) (see 4 papers)
28% identity, 86% coverage: 17:265/289 of query aligns to 31:275/315 of P0A717
Sites not aligning to the query:
P9WKE3 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
29% identity, 71% coverage: 77:280/289 of query aligns to 97:301/326 of P9WKE3
Sites not aligning to the query:
7xmvA E.Coli phosphoribosylpyrophosphate (prpp) synthetase type a(amp/adp) filament bound with adp, amp and r5p (see paper)
28% identity, 86% coverage: 17:265/289 of query aligns to 29:267/307 of 7xmvA
7xmuA E.Coli phosphoribosylpyrophosphate (prpp) synthetase type a filament bound with adp, pi and r5p (see paper)
28% identity, 86% coverage: 17:265/289 of query aligns to 29:267/307 of 7xmuA
Q97Z86 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
26% identity, 87% coverage: 16:266/289 of query aligns to 27:272/291 of Q97Z86
6nfeA Crystal structure of ribose-phosphate pyrophosphokinase from legionella pneumophila with bound amp, adp, and ribose-5-phosphate
26% identity, 85% coverage: 19:265/289 of query aligns to 32:268/298 of 6nfeA
2hcrA Crystal structure of human phosphoribosyl pyrophosphate synthetase 1 in complex with amp(atp), cadmium and sulfate ion (see paper)
30% identity, 74% coverage: 77:289/289 of query aligns to 87:298/305 of 2hcrA
8dbkB Human prps1 with phosphate, atp, and r5p; hexamer with resolved catalytic loops (see paper)
30% identity, 74% coverage: 77:289/289 of query aligns to 88:305/316 of 8dbkB
Sites not aligning to the query:
8dbeA Human prps1 with adp; hexamer (see paper)
30% identity, 74% coverage: 77:289/289 of query aligns to 88:305/316 of 8dbeA
Sites not aligning to the query:
P60891 Ribose-phosphate pyrophosphokinase 1; PPRibP; Phosphoribosyl pyrophosphate synthase I; PRS-I; EC 2.7.6.1 from Homo sapiens (Human) (see 5 papers)
30% identity, 74% coverage: 77:289/289 of query aligns to 89:306/318 of P60891
Sites not aligning to the query:
6nfeB Crystal structure of ribose-phosphate pyrophosphokinase from legionella pneumophila with bound amp, adp, and ribose-5-phosphate
26% identity, 85% coverage: 19:265/289 of query aligns to 32:269/299 of 6nfeB
7yk1A Structural basis of human prps2 filaments (see paper)
30% identity, 74% coverage: 77:289/289 of query aligns to 88:296/306 of 7yk1A
Sites not aligning to the query:
5t3oA Crystal structure of the phosphorybosylpyrophosphate synthetase ii from thermus thermophilus (see paper)
30% identity, 74% coverage: 77:289/289 of query aligns to 87:299/307 of 5t3oA
Sites not aligning to the query:
7pn0A Crystal structure of the phosphorybosylpyrophosphate synthetase ii from thermus thermophilus at r32 space group
30% identity, 74% coverage: 77:289/289 of query aligns to 88:300/312 of 7pn0A
Q63XL8 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Burkholderia pseudomallei (strain K96243) (see paper)
26% identity, 89% coverage: 21:276/289 of query aligns to 38:290/318 of Q63XL8
O94413 Ribose-phosphate pyrophosphokinase 2; Phosphoribosyl pyrophosphate synthase 2; EC 2.7.6.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
29% identity, 83% coverage: 51:289/289 of query aligns to 65:309/321 of O94413
8dbgA Human prps1 with phosphate and atp; hexamer (see paper)
29% identity, 74% coverage: 77:289/289 of query aligns to 88:298/309 of 8dbgA
Sites not aligning to the query:
4twbA Sulfolobus solfataricus ribose-phosphate pyrophosphokinase (see paper)
25% identity, 87% coverage: 16:266/289 of query aligns to 27:259/278 of 4twbA
>BWI76_RS25955 FitnessBrowser__Koxy:BWI76_RS25955
MSEKFTLELDDEAFTLASGVFPDGAVWLKVTDQLPPSARLMRIRAVTLRDMNDFMLLAQL
VEAVRHVTDVAFSHLELPWLPWARQDRHMVPGDSFALKVFARQLNTLGFDKVVVLDPHSD
AAAAAVNNMVAVAQQHCLLQSAVLRQAIATGELMLVAPDAGALKKIHPVAKACGAGEFAI
LGKERDLASGALTSFSLLAGDVAGKAVLIVDDLCDAGGTFIGSAQVLREAGARSVSLYVT
HGIFSKGVEHLLNNGIDAVYATTSLTSPALAHPQLELIDIDAIYRAHWG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory