SitesBLAST
Comparing BWI76_RS26190 BWI76_RS26190 glycerol-3-phosphate dehydrogenase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
2qcuB Crystal structure of glycerol-3-phosphate dehydrogenase from escherichia coli (see paper)
88% identity, 100% coverage: 1:502/502 of query aligns to 1:501/501 of 2qcuB
- binding flavin-adenine dinucleotide: I9 (= I9), G12 (= G12), I13 (= I13), N14 (= N14), E33 (= E33), A34 (= A34), C39 (= C39), T41 (= T41), S42 (= S42), S45 (= S45), S46 (= S46), L48 (= L48), H50 (= H50), A172 (= A172), T206 (= T206), W209 (= W209), G231 (= G231), R317 (= R317), G353 (= G353), K354 (= K354), L355 (= L355), T356 (= T356)
- binding phosphate ion: R54 (= R54), Y55 (= Y55), R317 (= R317), R332 (= R332)
2r46A Crystal structure of escherichia coli glycerol-3-phosphate dehydrogenase in complex with 2-phosphopyruvic acid. (see paper)
89% identity, 98% coverage: 1:493/502 of query aligns to 1:493/495 of 2r46A
- binding flavin-adenine dinucleotide: I9 (= I9), G12 (= G12), I13 (= I13), N14 (= N14), L32 (= L32), E33 (= E33), A34 (= A34), T41 (= T41), S42 (= S42), A44 (= A44), S45 (= S45), S46 (= S46), L48 (= L48), A172 (= A172), T206 (= T206), G231 (= G231), R317 (= R317), G353 (= G353), K354 (= K354), L355 (= L355), T356 (= T356)
- binding phosphoenolpyruvate: R54 (= R54), Y55 (= Y55), R254 (= R254), T270 (= T270), D272 (= D272), R317 (= R317), R332 (= R332)
- binding n-(tris(hydroxymethyl)methyl)-3-aminopropanesulfonic acid: Q157 (= Q157), V455 (= V455), D456 (≠ E456), H457 (= H457), W459 (= W459)
2r45A Crystal structure of escherichia coli glycerol-3-phosphate dehydrogenase in complex with 2-phospho-d-glyceric acid (see paper)
89% identity, 98% coverage: 1:493/502 of query aligns to 1:493/495 of 2r45A
- binding 2-phosphoglyceric acid: R54 (= R54), Y55 (= Y55), R254 (= R254), I255 (= I255), T270 (= T270), R317 (= R317), R332 (= R332)
- binding flavin-adenine dinucleotide: I9 (= I9), G12 (= G12), I13 (= I13), N14 (= N14), E33 (= E33), A34 (= A34), C39 (= C39), A40 (= A40), T41 (= T41), S42 (= S42), A44 (= A44), S45 (= S45), S46 (= S46), L48 (= L48), A172 (= A172), T206 (= T206), G207 (= G207), W209 (= W209), G231 (= G231), R317 (= R317), G353 (= G353), K354 (= K354), L355 (= L355), T356 (= T356)
- binding phosphate ion: Q212 (= Q212), G277 (= G277), P279 (= P279), V310 (= V310), Y398 (= Y398), R401 (≠ K401), R405 (≠ H405), R462 (= R462), D464 (= D464), W468 (= W468)
- binding n-(tris(hydroxymethyl)methyl)-3-aminopropanesulfonic acid: Q157 (= Q157), V160 (= V160), V455 (= V455), D456 (≠ E456), H457 (= H457), W459 (= W459)
Q9SS48 Glycerol-3-phosphate dehydrogenase SDP6, mitochondrial; Protein SUGAR-DEPENDENT 6; EC 1.1.5.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 96% coverage: 5:484/502 of query aligns to 75:581/629 of Q9SS48
- S86 (≠ A16) mutation to F: In spd6-2; loss of 90% of activity.
- E546 (= E448) mutation to G: In spd6-1; loss of 90% of activity.
2rgoB Structure of alpha-glycerophosphate oxidase from streptococcus sp.: A template for the mitochondrial alpha-glycerophosphate dehydrogenase (see paper)
29% identity, 90% coverage: 26:476/502 of query aligns to 39:480/530 of 2rgoB
- binding flavin-adenine dinucleotide: E46 (= E33), M47 (≠ A34), Q48 (≠ N35), T54 (= T41), S55 (= S42), S58 (= S45), T59 (≠ S46), A193 (= A172), S227 (≠ T206), G228 (= G207), W230 (= W209), L338 (≠ V316), R339 (= R317), Y350 (≠ S326), K374 (= K354), I375 (≠ L355), T376 (= T356)
Sites not aligning to the query:
2rgoA Structure of alpha-glycerophosphate oxidase from streptococcus sp.: A template for the mitochondrial alpha-glycerophosphate dehydrogenase (see paper)
29% identity, 90% coverage: 26:476/502 of query aligns to 41:509/557 of 2rgoA
- binding flavin-adenine dinucleotide: E48 (= E33), M49 (≠ A34), Q50 (≠ N35), T56 (= T41), S57 (= S42), A197 (= A172), S232 (≠ T206), G233 (= G207), W235 (= W209), G257 (= G231), G344 (= G315), L345 (≠ V316), Y357 (≠ Q328), K382 (= K354), I383 (≠ L355), T384 (= T356)
Sites not aligning to the query:
3da1A X-ray structure of the glycerol-3-phosphate dehydrogenase from bacillus halodurans complexed with fad. Northeast structural genomics consortium target bhr167.
30% identity, 93% coverage: 5:471/502 of query aligns to 20:442/496 of 3da1A
- binding flavin-adenine dinucleotide: I24 (= I9), G27 (= G12), I28 (= I13), T29 (≠ N14), E48 (= E33), M49 (≠ A34), G55 (≠ A40), S57 (= S42), S60 (= S45), T61 (≠ S46), L63 (= L48), H65 (= H50), V151 (≠ A172), G187 (= G207), W189 (= W209), L193 (≠ F213), G210 (= G231), T250 (= T270), G296 (= G315), R298 (= R317), G319 (= G353), K320 (= K354), L321 (= L355)
Query Sequence
>BWI76_RS26190 BWI76_RS26190 glycerol-3-phosphate dehydrogenase
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEANDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPSS
TGLRFGTESVLKPEIVRGFEYSDCWVDDARMVLANAQMVVRKGGEVRTRTRAISAKRENG
LWIVEAEDIDSGERFTWQARGLVNATGPWVKQFFDEGMHLRSPYGIRLIKGSHIVVPRVH
AQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVAIDGKEINYLLNVYNAHF
KKTLTRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGQAPLLSVFGGKLTTYRK
LAEHALEKLTPYYKGIGPAWTKTAVLPGGDIGGDRDDYAAKLRRHFAFISESMARHYART
YGSNSEWILGEATSLADLGEDFGHEFYEAELRYLVEHEWVRRLDDAIWRRTKQGMWLNAE
QQARISEWLAQHAGKSELSLAS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory