SitesBLAST
Comparing BWI76_RS26540 BWI76_RS26540 D-isomer specific 2-hydroxyacid dehydrogenase family protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
39% identity, 96% coverage: 4:307/317 of query aligns to 2:304/304 of 1wwkA
- active site: S96 (≠ N97), R230 (= R233), D254 (= D257), E259 (= E262), H278 (= H281)
- binding nicotinamide-adenine-dinucleotide: V100 (= V101), G146 (= G148), F147 (≠ V149), G148 (= G150), R149 (≠ N151), I150 (= I152), Y168 (= Y171), D169 (= D172), P170 (= P173), V201 (≠ C204), P202 (= P205), T207 (= T210), T228 (= T231), S229 (≠ A232), D254 (= D257), H278 (= H281), G280 (= G283)
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
34% identity, 96% coverage: 4:308/317 of query aligns to 8:310/533 of O43175
- T78 (≠ A73) binding
- R135 (≠ K131) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ NI 151:152) binding
- D175 (= D172) binding
- T207 (≠ C204) binding
- CAR 234:236 (≠ TAR 231:233) binding
- D260 (= D257) binding
- V261 (= V258) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HIGA 281:284) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
34% identity, 96% coverage: 4:307/317 of query aligns to 4:305/305 of 6plfA
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
35% identity, 93% coverage: 4:299/317 of query aligns to 3:296/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (≠ I147), G147 (= G148), L148 (≠ V149), G149 (= G150), R150 (≠ N151), I151 (= I152), G152 (= G153), D170 (= D172), H201 (= H203), T202 (≠ C204), P203 (= P205)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
35% identity, 93% coverage: 4:299/317 of query aligns to 3:296/302 of 6rihA
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
35% identity, 93% coverage: 4:299/317 of query aligns to 2:295/297 of 6rj3A
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
35% identity, 93% coverage: 4:299/317 of query aligns to 3:296/303 of 6plgA
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
35% identity, 93% coverage: 4:299/317 of query aligns to 3:296/301 of 6rj5A
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
35% identity, 93% coverage: 4:299/317 of query aligns to 2:295/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (= N97), A100 (≠ V101), R149 (≠ N151), I150 (= I152), Y168 (= Y171), D169 (= D172), P170 (= P173), I171 (≠ Y174), H200 (= H203), T201 (≠ C204), P202 (= P205), T207 (= T210), C228 (≠ T231), A229 (= A232), R230 (= R233), H277 (= H281), G279 (= G283)
7dkmA Phgdh covalently linked to oridonin (see paper)
35% identity, 93% coverage: 4:299/317 of query aligns to 4:297/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ A73), A102 (≠ V101), G148 (= G148), R151 (≠ N151), I152 (= I152), Y170 (= Y171), D171 (= D172), P172 (= P173), I173 (≠ Y174), H202 (= H203), T203 (≠ C204), P204 (= P205), T209 (= T210), C230 (≠ T231), A231 (= A232), R232 (= R233), H279 (= H281), G281 (= G283)
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: C14 (≠ E14), K17 (≠ E17), I18 (≠ Y18), E293 (≠ L295)
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
35% identity, 90% coverage: 16:299/317 of query aligns to 12:293/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G150), I148 (= I152), Y166 (= Y171), D167 (= D172), P168 (= P173), I169 (≠ Y174), I170 (≠ K175), H198 (= H203), T199 (≠ C204), L208 (≠ F213), R228 (= R233)
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
34% identity, 93% coverage: 4:299/317 of query aligns to 2:287/292 of 6plfB
- binding 4-{(1S)-1-[(5-chloro-6-{[(5S)-2-oxo-1,3-oxazolidin-5-yl]methoxy}-1H-indole-2-carbonyl)amino]-2-hydroxyethyl}benzoic acid: R141 (≠ N151), Y160 (= Y171), D161 (= D172), P162 (= P173), I164 (≠ K175), L179 (≠ F190), T193 (≠ C204), P194 (= P205), S198 (≠ E209), L202 (≠ F213)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
38% identity, 81% coverage: 35:291/317 of query aligns to 37:298/334 of 5aovA
- active site: L100 (≠ N97), R241 (= R233), D265 (= D257), E270 (= E262), H288 (= H281)
- binding glyoxylic acid: M52 (≠ R50), L53 (= L51), L53 (= L51), Y74 (≠ H71), A75 (≠ G72), V76 (≠ A73), G77 (= G74), R241 (= R233), H288 (= H281)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ A73), T104 (≠ V101), F158 (≠ V149), G159 (= G150), R160 (≠ N151), I161 (= I152), S180 (≠ D172), R181 (≠ P173), A211 (≠ H203), V212 (≠ C204), P213 (= P205), T218 (= T210), I239 (≠ T231), A240 (= A232), R241 (= R233), H288 (= H281), G290 (= G283)
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
36% identity, 88% coverage: 31:308/317 of query aligns to 30:305/525 of 3ddnB
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
36% identity, 88% coverage: 31:308/317 of query aligns to 29:304/526 of 3dc2A
Sites not aligning to the query:
P87228 Putative D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
36% identity, 90% coverage: 4:289/317 of query aligns to 57:352/466 of P87228
- S87 (≠ E33) modified: Phosphoserine
- S258 (≠ T207) modified: Phosphoserine
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
37% identity, 81% coverage: 35:291/317 of query aligns to 36:297/332 of 6biiA
- active site: L99 (≠ N97), R240 (= R233), D264 (= D257), E269 (= E262), H287 (= H281)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (≠ A73), T103 (≠ V101), G156 (= G148), F157 (≠ V149), G158 (= G150), R159 (≠ N151), I160 (= I152), A179 (≠ T176), R180 (≠ Q177), S181 (≠ Q178), K183 (≠ I180), V211 (≠ C204), P212 (= P205), E216 (= E209), T217 (= T210), V238 (≠ T231), A239 (= A232), R240 (= R233), D264 (= D257), H287 (= H281), G289 (= G283)
2p9eA Crystal structure of g336v mutant of e.Coli phosphoglycerate dehydrogenase (see paper)
34% identity, 93% coverage: 4:298/317 of query aligns to 8:305/406 of 2p9eA
- active site: N104 (= N97), R236 (= R233), D260 (= D257), E265 (= E262), H288 (= H281)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G156 (= G150), H157 (≠ N151), I158 (= I152), Y176 (= Y171), D177 (= D172), I178 (≠ T176), H206 (= H203), V207 (≠ C204), P208 (= P205), S212 (≠ E209), A234 (≠ T231), S235 (≠ A232), R236 (= R233), H288 (= H281), G290 (= G283)
1ybaA The active form of phosphoglycerate dehydrogenase (see paper)
34% identity, 93% coverage: 4:298/317 of query aligns to 8:305/406 of 1ybaA
- active site: N104 (= N97), R236 (= R233), D260 (= D257), E265 (= E262), H288 (= H281)
- binding 2-oxoglutaric acid: R56 (= R50), S57 (vs. gap), C79 (≠ G72), I80 (≠ A73)
- binding nicotinamide-adenine-dinucleotide: I80 (≠ A73), F102 (≠ I95), V108 (= V101), G154 (= G148), G156 (= G150), H157 (≠ N151), I158 (= I152), Y176 (= Y171), D177 (= D172), I178 (≠ T176), K181 (≠ Q179), H206 (= H203), V207 (≠ C204), P208 (= P205), A234 (≠ T231), S235 (≠ A232), R236 (= R233), H288 (= H281), G290 (= G283)
- binding phosphate ion: G81 (= G74), N83 (≠ D76)
1psdA The allosteric ligand site in the vmax-type cooperative enzyme phosphoglycerate dehydrogenase (see paper)
34% identity, 93% coverage: 4:298/317 of query aligns to 6:303/404 of 1psdA
- active site: N102 (= N97), R234 (= R233), D258 (= D257), E263 (= E262), H286 (= H281)
- binding nicotinamide-adenine-dinucleotide: N102 (= N97), H155 (≠ N151), I156 (= I152), D175 (= D172), I176 (≠ T176), K179 (≠ Q179), H204 (= H203), V205 (≠ C204), P206 (= P205), A232 (≠ T231), S233 (≠ A232), R234 (= R233), H286 (= H281)
Sites not aligning to the query:
Query Sequence
>BWI76_RS26540 BWI76_RS26540 D-isomer specific 2-hydroxyacid dehydrogenase family protein
MTYKILLPQEIMAEGREYLESRGYQLINGSGMEEEDIIRDIGDCDGIIVRLSKMSDRVFE
AAKKLKVVARHGAGYDTVDLESAKRHGVVVLNAPIANSMSVAELAIFYMLHCSRNFKLVQ
EKMLEDYYWAKLRTPKVELDGKTLGLIGVGNIGSRVAIKALHGFNMKVIAYDPYKTQQQI
PEGVELTDDFDRIFTESDFVSLHCPTTAETTDFVGEKQFSMMKPSAYFINTARGKLVDEK
ALYHALSTHAIAGAGVDVLKKEPFDANDPIFSLSNIVIAPHIGAATIEATDRASLHSAIG
IDEVLSGKKPSWPVPGF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory