Comparing BWI76_RS26545 FitnessBrowser__Koxy:BWI76_RS26545 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
3nojA The structure of hmg/cha aldolase from the protocatechuate degradation pathway of pseudomonas putida (see paper)
28% identity, 93% coverage: 16:230/232 of query aligns to 19:232/235 of 3nojA
A5W059 4-hydroxy-4-methyl-2-oxoglutarate aldolase/4-carboxy-4-hydroxy-2-oxoadipate aldolase; HMG/CHA aldolase; Oxaloacetate decarboxylase; OAA decarboxylase; EC 4.1.3.17; EC 4.1.1.112 from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1) (see paper)
28% identity, 93% coverage: 16:230/232 of query aligns to 20:233/238 of A5W059
1nxjA Structure of rv3853 from mycobacterium tuberculosis (see paper)
34% identity, 48% coverage: 68:179/232 of query aligns to 46:156/156 of 1nxjA
Sites not aligning to the query:
2yjvC Crystal structure of e. Coli regulator of ribonuclease activity a (rraa) bound to fragment of dead-box protein rhlb (see paper)
31% identity, 55% coverage: 52:178/232 of query aligns to 28:152/158 of 2yjvC
>BWI76_RS26545 FitnessBrowser__Koxy:BWI76_RS26545
MTIGNRIFLKRPACSVDLLKEFEQLPAANIADTMNRIAVLGNGIKRISSPKKPIMAGFAI
TVKVRAGDNLMLHAALDMAGENDVIVVSNEGDRSRALMGEIMVAYAHCMKKVAGIVLDGP
IRDIDALSVLDFPLFATGSNPAGPFKQGPGEVNTPIAVGGVAVCPGDLIVGDADGVIVIP
LGDAEAVLNKAKDYAKFDASKVEAAKNGTANRLWVKKSLDETGVEFIDDMYR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory