Comparing BWI76_RS27020 FitnessBrowser__Koxy:BWI76_RS27020 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09099 Xylulose kinase; XK; Xylulokinase; 1-deoxy-D-xylulokinase; EC 2.7.1.17; EC 2.7.1.- from Escherichia coli (strain K12) (see paper)
85% identity, 100% coverage: 1:484/484 of query aligns to 1:484/484 of P09099
2itmA Crystal structure of the e. Coli xylulose kinase complexed with xylulose (see paper)
83% identity, 100% coverage: 1:484/484 of query aligns to 1:476/476 of 2itmA
3i8bA The crystal structure of xylulose kinase from bifidobacterium adolescentis
30% identity, 90% coverage: 1:436/484 of query aligns to 5:472/506 of 3i8bA
3ll3B The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
27% identity, 99% coverage: 3:482/484 of query aligns to 5:474/490 of 3ll3B
3ll3A The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
27% identity, 99% coverage: 3:482/484 of query aligns to 6:476/492 of 3ll3A
3kzbA Crystal structure of xylulokinase from chromobacterium violaceum
29% identity, 94% coverage: 1:456/484 of query aligns to 4:471/498 of 3kzbA
6k76A Glycerol kinase form thermococcus kodakarensis, complex structure with substrate.
26% identity, 90% coverage: 3:436/484 of query aligns to 2:435/485 of 6k76A
Q5HGD2 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Staphylococcus aureus (strain COL)
24% identity, 95% coverage: 3:464/484 of query aligns to 6:478/498 of Q5HGD2
3ge1A 2.7 angstrom crystal structure of glycerol kinase (glpk) from staphylococcus aureus in complex with adp and glycerol
24% identity, 95% coverage: 3:464/484 of query aligns to 7:479/499 of 3ge1A
O86033 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
25% identity, 85% coverage: 3:415/484 of query aligns to 6:431/497 of O86033
6udeB Crystal structure of glycerol kinase from elizabethkingia anophelis nuhp1 in complex with adp and glycerol
24% identity, 95% coverage: 1:461/484 of query aligns to 4:472/495 of 6udeB
P0A6F3 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Escherichia coli (strain K12) (see 10 papers)
24% identity, 96% coverage: 3:466/484 of query aligns to 8:485/502 of P0A6F3
Sites not aligning to the query:
1glfO Crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation (see paper)
24% identity, 96% coverage: 3:466/484 of query aligns to 6:483/498 of 1glfO
1bo5O Crystal structure of the complex between escherichia coli glycerol kinase and the allosteric regulator fructose 1,6-bisphosphate. (see paper)
24% identity, 96% coverage: 3:466/484 of query aligns to 6:483/498 of 1bo5O
1gldG Cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation (see paper)
24% identity, 96% coverage: 3:466/484 of query aligns to 4:474/489 of 1gldG
1glcG Cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation (see paper)
24% identity, 96% coverage: 3:466/484 of query aligns to 4:474/489 of 1glcG
1glbG Structure of the regulatory complex of escherichia coli iiiglc with glycerol kinase (see paper)
24% identity, 96% coverage: 3:466/484 of query aligns to 4:474/489 of 1glbG
P18157 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Bacillus subtilis (strain 168) (see paper)
23% identity, 95% coverage: 3:464/484 of query aligns to 6:478/496 of P18157
1bu6Y Crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation (see paper)
24% identity, 96% coverage: 3:466/484 of query aligns to 6:483/499 of 1bu6Y
2w41B Crystal structure of plasmodium falciparum glycerol kinase with adp (see paper)
23% identity, 90% coverage: 3:436/484 of query aligns to 11:460/507 of 2w41B
>BWI76_RS27020 FitnessBrowser__Koxy:BWI76_RS27020
MYIGIDLGTSGVKAILLNEQGEVVASHTEKLNVSRPHPLWSEQDPEHWWLATDSAMKALG
AQHSLRAVKALGIAGQMHGATLLDKQQRVLRPAILWNDGRCGEECALLEEKVSRSRQITG
NLMMPGFTAPKLLWVQRHEPEIFRQVDKVLLPKDYLRLRMTGEFASDMSDAAGTMWMDVA
RRDWSDEMLAACGLSRDNMPALFEGCEVTGSLRPAVAQAWNMPEVLVVAGGGDNAAGAVG
VGMADAGQAMLSLGTSGVYFAVSDGFLSKPESAVHSFCHALPGRWHLMSVMLSAASCLDW
AATLTGLGTVPALIAAAEAANDDADPVWFLPYLSGERTPHNNPQAKGVFFGLTHQHGPAE
LARAVLEGVGYALADGMDVVHACGVKPESVTLIGGGARSAYWRQMLADISGQQLDFRTGG
DVGPALGAARLAQLALHRNVAFSDLLPQLPLEQAHLPDAERFARYAPRRETFRQIYQQLL
PLMS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory