Comparing BWI76_RS27035 FitnessBrowser__Koxy:BWI76_RS27035 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
47% identity, 98% coverage: 1:502/513 of query aligns to 1:492/501 of P04983
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 48% coverage: 4:250/513 of query aligns to 4:254/254 of 1g6hA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
30% identity, 42% coverage: 4:218/513 of query aligns to 1:212/240 of 4ymuJ
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 48% coverage: 4:247/513 of query aligns to 4:251/253 of 1g9xB
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
27% identity, 42% coverage: 4:219/513 of query aligns to 2:213/241 of 4u00A
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 43% coverage: 1:219/513 of query aligns to 14:225/378 of P69874
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
28% identity, 42% coverage: 4:221/513 of query aligns to 3:216/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
28% identity, 42% coverage: 4:221/513 of query aligns to 3:216/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
28% identity, 42% coverage: 4:221/513 of query aligns to 3:216/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
28% identity, 42% coverage: 4:221/513 of query aligns to 3:216/242 of 2oljA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
28% identity, 42% coverage: 5:222/513 of query aligns to 3:216/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
28% identity, 42% coverage: 5:222/513 of query aligns to 3:216/238 of 6s8gA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
28% identity, 42% coverage: 5:222/513 of query aligns to 3:216/235 of 6mhzA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
28% identity, 42% coverage: 5:222/513 of query aligns to 3:216/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
28% identity, 42% coverage: 5:222/513 of query aligns to 3:216/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
28% identity, 42% coverage: 5:222/513 of query aligns to 3:216/233 of 6b8bA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 42% coverage: 4:221/513 of query aligns to 1:220/343 of P30750
Sites not aligning to the query:
6mbnA Lptb e163q in complex with atp (see paper)
28% identity, 43% coverage: 2:222/513 of query aligns to 1:217/241 of 6mbnA
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
30% identity, 42% coverage: 4:221/513 of query aligns to 2:221/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
30% identity, 42% coverage: 4:221/513 of query aligns to 2:221/344 of 3tuzC
Sites not aligning to the query:
>BWI76_RS27035 FitnessBrowser__Koxy:BWI76_RS27035
MSWLLEMKNITKTFGAVKAIDNVSLRLNAGEVVSLCGENGSGKSTLMKVLCGIYPHGSYE
GEIIFSGETLQPGHIRDTERKGIAIIHQELALVKHLTVLENIFLGAEISRHGLLDYETMT
LRCEKLLAQVNLAISPDTRVGDLGLGQQQLVEIAKALNKQVRLLILDEPTASLTEQETAI
LLNIIRDLQNHGIACIYISHKLNEVKAISDTICVIRDGQHIGTRNADGMSEDDIITMMVG
RELTALYPSEAHSCGDEILRVENLTAWHPVNRHIKRVNDVSFSLRRGEILGIAGLVGAGR
TEAVQCLFGVWPGRWQGKIFIDGQPVTIHTCQQAIAQGIAMVPEDRKKDGIVPVMAVGKN
ITLAALNQFTGPLSSLDDAGEQLCIQQSIQRLKIKTSSPELAIGRLSGGNQQKAILARCL
LLNPRILILDEPTRGIDIGAKYEIYKLINQLVQQGIAVIVISSELPEVLGLSDRVLVMHE
GKLKANLINQGLTQEQVMEAALRSERHVEEHVV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory