Comparing BWI76_RS27065 FitnessBrowser__Koxy:BWI76_RS27065 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3if2A Crystal structure of putative amino-acid aminotransferase (yp_265399.1) from psychrobacter arcticum 273-4 at 2.50 a resolution
46% identity, 99% coverage: 1:416/419 of query aligns to 2:437/437 of 3if2A
1wstA Crystal structure of multiple substrate aminotransferase (msat) from thermococcus profundus
30% identity, 54% coverage: 184:410/419 of query aligns to 176:397/403 of 1wstA
Sites not aligning to the query:
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
25% identity, 73% coverage: 68:372/419 of query aligns to 62:354/385 of Q56232
Sites not aligning to the query:
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
25% identity, 73% coverage: 68:372/419 of query aligns to 62:354/382 of 1bkgA
1bjwA Aspartate aminotransferase from thermus thermophilus (see paper)
25% identity, 73% coverage: 68:372/419 of query aligns to 62:354/382 of 1bjwA
Sites not aligning to the query:
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
25% identity, 73% coverage: 68:372/419 of query aligns to 62:354/382 of 1b5oA
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
23% identity, 85% coverage: 60:416/419 of query aligns to 47:385/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
23% identity, 85% coverage: 60:416/419 of query aligns to 47:385/388 of 1gd9A
1gc4A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate (see paper)
25% identity, 73% coverage: 68:372/419 of query aligns to 62:354/382 of 1gc4A
Sites not aligning to the query:
1gc3A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with tryptophan (see paper)
25% identity, 73% coverage: 68:372/419 of query aligns to 62:354/382 of 1gc3A
Sites not aligning to the query:
P14909 Aspartate aminotransferase; AspAT; Transaminase A; EC 2.6.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 3 papers)
21% identity, 84% coverage: 60:411/419 of query aligns to 57:397/402 of P14909
Sites not aligning to the query:
3cbfA Crystal structure of lysn, alpha-aminoadipate aminotransferase, from thermus thermophilus hb27 (see paper)
23% identity, 91% coverage: 30:410/419 of query aligns to 28:387/392 of 3cbfA
Sites not aligning to the query:
2egyA Crystal structure of lysn, alpha-aminoadipate aminotransferase (substrate free form), from thermus thermophilus hb27
23% identity, 91% coverage: 30:410/419 of query aligns to 28:387/392 of 2egyA
2zyjA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-glutamate), from thermus thermophilus hb27 (see paper)
23% identity, 91% coverage: 30:410/419 of query aligns to 32:391/397 of 2zyjA
Sites not aligning to the query:
8ffuA Structure of gntc, a plp-dependent enzyme catalyzing l-enduracididine biosynthesis from (s)-4-hydroxy-l-arginine, with the substrate bound (see paper)
26% identity, 69% coverage: 91:379/419 of query aligns to 62:333/360 of 8ffuA
Sites not aligning to the query:
2z1yA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27
23% identity, 75% coverage: 95:410/419 of query aligns to 81:383/389 of 2z1yA
Sites not aligning to the query:
3eleA Crystal structure of amino transferase (rer070207001803) from eubacterium rectale at 2.10 a resolution
23% identity, 86% coverage: 38:399/419 of query aligns to 43:383/398 of 3eleA
2vgzA Crystal structure of human kynurenine aminotransferase ii (see paper)
22% identity, 92% coverage: 29:412/419 of query aligns to 19:413/414 of 2vgzA
P04694 Tyrosine aminotransferase; TAT; L-tyrosine:2-oxoglutarate aminotransferase; EC 2.6.1.5 from Rattus norvegicus (Rat) (see 2 papers)
27% identity, 49% coverage: 95:300/419 of query aligns to 133:333/454 of P04694
Sites not aligning to the query:
Q58097 (5-formylfuran-3-yl)methyl phosphate transaminase; 4-HFC-P:alanine aminotransferase; EC 2.6.1.108 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
25% identity, 81% coverage: 68:407/419 of query aligns to 60:366/370 of Q58097
>BWI76_RS27065 FitnessBrowser__Koxy:BWI76_RS27065
MTFSLFGDKFTRHSGITRLMEDLNDGLRTPGAIMLGGGNPAQIPEMNDYFHSLLADMLNS
GKALDALCNYDGPQGKSELLTLLAQMLRDELGWEIEPQNIALTNGSQSAFFYLFNLFAGR
RADGTTRKVLFPLTPEYIGYADSGLEEDLFVATRPNIELLPEGQFKYHVDFEHLQVTDET
GMICVSRPTNPTGNVITDDELIKLDALANQHGIPLVIDNAYGVPFPGIIFSDARPLWNPN
IVLCMSLSKLGLPGSRCGIIIANEKIITAISNMNGIISLAPGGMGPAMMCEMIKRNDLLR
LSETVIKPFYYQRVQETIAIIRRYLPEDRCLIHKPEGAIFLWLWFKDLPISTELLYQRLK
KRGVLMVPGDYFFPGLDKPWPHTHQCMRMNYVPDPEKIEAGVRILAEEVERAWREQDPS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory