SitesBLAST
Comparing BWI76_RS27095 FitnessBrowser__Koxy:BWI76_RS27095 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
Q9NRA2 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Membrane glycoprotein HP59; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Homo sapiens (Human) (see 8 papers)
27% identity, 74% coverage: 62:385/439 of query aligns to 113:441/495 of Q9NRA2
- K136 (= K85) to E: in SD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transporter activity, but retains appreciable H(+)-coupled sialic acid transporter activity; dbSNP:rs80338795
- H183 (≠ L130) to R: in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity; dbSNP:rs119491109
- LL 198:199 (≠ AN 145:146) mutation to AA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- IL 266:267 (≠ LV 213:214) mutation to LA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- SSLRN 268:272 (≠ ETLAA 215:219) natural variant: Missing (in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity)
- G328 (= G280) to E: in ISSD; some patients may manifest a milder phenotype consistent with Salla disease; markedly decreases H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs386833996
- P334 (= P286) to R: in ISSD; does not affect intracellular localization, targeted to lysosomes; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs119491110
- G371 (≠ M322) to V: in ISSD; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs777862172
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane.; LL→GG: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R → C: in SD; frequent variant in Finland; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transport activity, but retains appreciable H(+)-coupled sialic acid and nitrate transporter activity; dbSNP:rs80338794
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
25% identity, 95% coverage: 1:418/439 of query aligns to 1:422/430 of P0AA76
- Y29 (= Y32) binding
- D31 (= D34) mutation to N: Loss of galactonate transport activity.
- R32 (= R35) binding
- Y64 (= Y68) binding
- E118 (= E122) mutation to Q: Loss of galactonate transport activity.
- W358 (= W354) binding
Q8BN82 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Mus musculus (Mouse) (see paper)
25% identity, 86% coverage: 62:437/439 of query aligns to 113:495/495 of Q8BN82
- H183 (≠ L130) mutation to R: Abolishes sialic acid transporter activity. Does not affect L-aspartate and L-glutamate transporter activity.
Sites not aligning to the query:
- 39 R→C: Completely abolishes L-aspartate and L-glutamate transporter activity. Retains appreciable H(+)-coupled sialic acid transporter activity.
Q5Q0U0 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 (Anion/sugar transporter), member 5; Vesicular excitatory amino acid transporter; VEAT from Rattus norvegicus (Rat) (see 2 papers)
27% identity, 74% coverage: 62:385/439 of query aligns to 113:441/495 of Q5Q0U0
- K136 (= K85) mutation to E: Markedly decreases H(+)-coupled sialic acid transporter activity.
- R168 (= R115) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- E171 (≠ L118) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-175.
- G172 (= G119) mutation to C: Decreases protein levels and alters subcellular localization.
- E175 (= E122) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-171.
- G176 (= G123) mutation to C: Decreases protein levels and alters subcellular localization.
- F179 (≠ L126) mutation to C: Decreases the affinity and transport rate for D-glucuronate. Does not affect H(+)-coupled sialic acid transporter activity.
- P180 (= P127) mutation to C: Decreases protein levels and alters subcellular localization.
- H183 (≠ L130) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
- W186 (≠ I133) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- SSLKN 268:272 (≠ ETLAA 215:219) mutation Missing: Abolishes H(+)-coupled sialic acid transporter activity.
- P334 (= P286) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
- G371 (≠ P314) mutation to V: Remains in the endoplasmic reticulum.
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R→C: Markedly decreases H(+)-coupled sialic acid transporter activity.
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
25% identity, 92% coverage: 14:418/439 of query aligns to 1:403/409 of 6e9nA
6e9oA E. Coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form (see paper)
25% identity, 92% coverage: 14:418/439 of query aligns to 4:387/393 of 6e9oA
Q03567 Uncharacterized transporter slc-17.2 from Caenorhabditis elegans (see paper)
25% identity, 77% coverage: 5:343/439 of query aligns to 2:370/493 of Q03567
- N69 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
Q9JI12 Vesicular glutamate transporter 2; VGluT2; Differentiation-associated BNPI; Differentiation-associated Na(+)-dependent inorganic phosphate cotransporter; Solute carrier family 17 member 6 from Rattus norvegicus (Rat) (see 2 papers)
22% identity, 86% coverage: 30:407/439 of query aligns to 93:483/582 of Q9JI12
- H128 (≠ G61) mutation to A: Greatly lowers L-glutamate transport.
- R184 (= R115) mutation R->A,E,K: Greatly lowers L-glutamate transport.
- E191 (= E122) mutation to A: Greatly lowers L-glutamate transport.; mutation E->D,Q: Lowers L-glutamate transport.
- R322 (≠ Y253) mutation to A: Loss of L-glutamate release. Abolishes the chloride ion conductance.
Sites not aligning to the query:
- 88 R→A: Impairs synaptic transmission. Abolishes the chloride ion conductance.
7t3nA R184q/e191q mutant of rat vesicular glutamate transporter 2 (vglut2)
22% identity, 86% coverage: 30:407/439 of query aligns to 35:425/452 of 7t3nA
Sites not aligning to the query:
P53322 High-affinity nicotinic acid transporter; Nicotinic acid permease from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
22% identity, 70% coverage: 5:311/439 of query aligns to 77:386/534 of P53322
- K283 (≠ E207) modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Q9C0U9 Uncharacterized transporter PB1C11.03 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
23% identity, 49% coverage: 32:244/439 of query aligns to 114:331/570 of Q9C0U9
Sites not aligning to the query:
- 14 modified: Phosphoserine
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
22% identity, 76% coverage: 85:418/439 of query aligns to 87:430/452 of Q5EXK5
- V311 (≠ S299) mutation to W: Loss of activity.
- D314 (= D302) mutation to A: Loss of activity.
Sites not aligning to the query:
- 82 D→A: Loss of activity.
Q9Y2C5 Probable small intestine urate exporter; Solute carrier family 17 member 4 from Homo sapiens (Human) (see 2 papers)
23% identity, 81% coverage: 67:423/439 of query aligns to 120:484/497 of Q9Y2C5
- A372 (≠ C312) to T: in dbSNP:rs11754288
Sites not aligning to the query:
- 66 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: Loss of glycosylation and significant reduction in the transport of thyroid hormones T3 and T4; when associated with A-75 and A-90.
- 75 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: Loss of glycosylation and significant reduction in the transport of thyroid hormones T3 and T4; when associated with A-66 and A-90.
- 90 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: Loss of glycosylation and significant reduction in the transport of thyroid hormones T3 and T4; when associated with A-75 and A-90.
Q51955 4-hydroxybenzoate transporter PcaK from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
24% identity, 90% coverage: 1:394/439 of query aligns to 1:414/448 of Q51955
- D41 (= D34) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- D44 (≠ N37) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- G85 (= G76) mutation to V: Abolishes 4-HBA transport and chemotaxis.
- D89 (≠ V80) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- G92 (≠ S83) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to C: No change in 4-HBA transport and chemotaxis.; mutation G->L,V: Abolishes 4-HBA transport and chemotaxis.; mutation to Q: Decrease in 4-HBA transport and strong decrease in chemotaxis.
- R124 (= R115) mutation to A: Abolishes 4-HBA transport.
- E144 (≠ N135) mutation to A: Strong decrease in 4-HBA transport.
- H183 (≠ R174) mutation to A: Decrease in 4-HBA transport and chemotaxis.
- D323 (= D302) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- H328 (≠ R307) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to R: Decrease in 4-HBA transport and loss of chemotaxis.
- R386 (≠ G368) mutation to A: Strong decrease in 4-HBA transport.
- R398 (≠ N378) mutation to A: Abolishes 4-HBA transport.
Sites not aligning to the query:
- 444 H→A: No change in 4-HBA transport and chemotaxis.
P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
23% identity, 74% coverage: 75:401/439 of query aligns to 70:372/403 of P77589
- D75 (≠ V80) mutation D->A,E: Lack of 3HPP transport activity.
- A272 (≠ S299) mutation to H: 30% increase in 3HPP transport activity.
- K276 (≠ R303) mutation to D: Lack of 3HPP transport activity.
Sites not aligning to the query:
- 27 E→A: Lack of 3HPP transport activity.; E→D: Slight decrease in 3HPP transport activity.
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
26% identity, 58% coverage: 53:305/439 of query aligns to 84:315/444 of Q8NLB7
- R103 (≠ Q72) mutation to A: Loss of transport activity.
- W309 (≠ S299) mutation to V: Loss of transport activity.
- D312 (= D302) mutation to A: Loss of transport activity.
- R313 (= R303) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 54 D→A: Loss of transport activity.; D→E: Retains 50% of its transport activity.
- 57 D→A: Loss of transport activity.; D→E: Retains 50% of its transport activity.
- 317 mutation I->H,Y: Loss of transport activity.
- 386 R→A: Loss of transport activity.
Q9GQQ0 Protein spinster; Protein benchwarmer; Protein diphthong from Drosophila melanogaster (Fruit fly) (see paper)
24% identity, 42% coverage: 7:190/439 of query aligns to 104:286/605 of Q9GQQ0
- E217 (= E122) mutation to K: In bnch(N); leads to storage in yolk spheres during oogenesis and results in widespread accumulation of enlarged lysosomal and late endosomal inclusions.
O59698 Uncharacterized transporter C36.01c from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
26% identity, 49% coverage: 83:296/439 of query aligns to 201:421/580 of O59698
Sites not aligning to the query:
- 99 modified: Phosphoserine
Query Sequence
>BWI76_RS27095 FitnessBrowser__Koxy:BWI76_RS27095
MNITSNSTTKDIPRQRWLRIIPPILITCIISYMDRVNIAFAMPGGMDADLGISATMAGLA
GGIFFIGYLFLQVPGGKIAVHGSGKKFIGWSLVAWAVISVLTGLITNQYQLLALRFLLGV
AEGGMLPVVLTMISNWFPDAERGRANAIVIMFVPIAGIITAPLSGWIITVLDWRWLFIIE
GLLSLVVLVLWAYTIYDRPQEARWISEAEKRYLVETLAAEQKAIAGTEVKNASLSAVLSD
KTMWQLIALNFFYQTGIYGYTLWLPTILKELTHSSMGQVGMLAILPYVGAIAGMFLFSSL
SDRTGKRKLFVCLPLIGFALCMFLSVALKNQIWLSYAALVGCGFFLQSAAGVFWTIPARL
FSAEMAGGARGVINALGNLGGFCGPYAVGVLITLYSKDAGVYCLAISLALAALMALLLPA
KCDAGAAPVKTINPHKRTA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory