Comparing BWI76_RS27160 BWI76_RS27160 PTS mannitol transporter subunit IICBA to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
P00550 PTS system mannitol-specific EIICBA component; EIICBA-Mtl; EII-Mtl; EC 2.7.1.197 from Escherichia coli (strain K12) (see 2 papers)
94% identity, 100% coverage: 1:636/636 of query aligns to 1:635/637 of P00550
P28008 PTS system mannitol-specific EIICB component; EIICB-Mtl; EII-Mtl; EC 2.7.1.197 from Staphylococcus carnosus (see paper)
51% identity, 73% coverage: 8:470/636 of query aligns to 16:517/518 of P28008
1j6tA Complex of enzyme iiamtl and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure (see paper)
93% identity, 22% coverage: 494:636/636 of query aligns to 1:143/144 of 1j6tA
C0H3V2 Mannitol-specific phosphotransferase enzyme IIA component; EIIA; EIII; PTS system mannitol-specific EIIA component from Bacillus subtilis (strain 168) (see paper)
42% identity, 22% coverage: 497:634/636 of query aligns to 4:139/143 of C0H3V2
O31645 PTS system mannose-specific EIIBCA component; EIIBCA-Man; EII-Man; EC 2.7.1.191 from Bacillus subtilis (strain 168) (see 2 papers)
31% identity, 17% coverage: 529:635/636 of query aligns to 540:647/650 of O31645
Sites not aligning to the query:
P46321 Probable licABCH operon regulator; EC 2.7.1.- from Bacillus subtilis (strain 168) (see paper)
25% identity, 24% coverage: 478:630/636 of query aligns to 485:631/641 of P46321
Sites not aligning to the query:
O31644 Transcriptional regulator ManR; Mannose operon transcriptional activator; EC 2.7.1.191 from Bacillus subtilis (strain 168) (see paper)
25% identity, 20% coverage: 502:627/636 of query aligns to 517:639/648 of O31644
Sites not aligning to the query:
>BWI76_RS27160 BWI76_RS27160 PTS mannitol transporter subunit IICBA
MSSDIKIKVQSFGRFLSNMVMPNIGAFIAWGIITALFIPTGWLPNETLAKLVGPMITYLL
PLLIGYTGGKLVGGERGGVVGAITTMGVIVGADMPMFLGSMIAGPLGGWAIKKFDVWVDG
KIKSGFEMLVNNFSAGIIGMILAILAFLGIGPAVEILSKILAAGVNFMVAHEMLPLASIF
VEPAKILFLNNAINHGIFSPLGIQQSHELGKSIFFLIEANPGPGMGVLLAYMFFGRGSAK
QSAGGAAIIHFLGGIHEIYFPYVLMNPRLILAVILGGMTGVFTLTILNGGLVSPASPGSI
LAVLAMTPKGAYFANIAAIVAAMAVSFVVAAVLLKTSKVKEEDDIEAATRRMHDMKAESK
GGATPLAAGDVANDLSHVRKIIVACDAGMGSSAMGAGVLRKKVQDAGLSNISVTNCAINN
LPPDVDLVITHRDLTERAMRQVPQAQHISLTNFLDSGLYTSLTERLVAAQRHTDNEEKVR
DSLKDSFDAADTNLFKLGAENIFLGRKAATKEEAILFAGEQLVKGGYVEPEYVQAMLDRE
KLTSTYLGESIAVPHGTIEAKDRVLKTGIVFCQYPEGVRFGEEEDEVARLVIGIAARNNE
HIQVITSLTNALDDESVIERLTKTTSVDEVLTLLKG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory