Comparing BWI76_RS27255 FitnessBrowser__Koxy:BWI76_RS27255 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AB77 2-amino-3-ketobutyrate coenzyme A ligase; AKB ligase; Glycine acetyltransferase; EC 2.3.1.29 from Escherichia coli (strain K12) (see paper)
94% identity, 100% coverage: 1:397/397 of query aligns to 1:398/398 of P0AB77
1fc4A 2-amino-3-ketobutyrate coa ligase (see paper)
94% identity, 100% coverage: 1:397/397 of query aligns to 4:401/401 of 1fc4A
7v58B Structural insights into the substrate selectivity of acyl-coa transferase (see paper)
69% identity, 100% coverage: 1:396/397 of query aligns to 3:399/400 of 7v58B
3tqxA Structure of the 2-amino-3-ketobutyrate coenzyme a ligase (kbl) from coxiella burnetii (see paper)
66% identity, 99% coverage: 4:396/397 of query aligns to 3:396/396 of 3tqxA
7bxsA 2-amino-3-ketobutyrate coa ligase from cupriavidus necator glycine binding form
60% identity, 99% coverage: 5:396/397 of query aligns to 7:399/399 of 7bxsA
7bxrA 2-amino-3-ketobutyrate coa ligase from cupriavidus necator 3- hydroxynorvaline binding form
60% identity, 99% coverage: 5:396/397 of query aligns to 7:399/399 of 7bxrA
7bxqA 2-amino-3-ketobutyrate coa ligase from cupriavidus necator l-threonine binding form
60% identity, 99% coverage: 5:396/397 of query aligns to 7:399/399 of 7bxqA
Q0P5L8 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial; AKB ligase; Aminoacetone synthase; Glycine acetyltransferase; EC 2.3.1.29 from Bos taurus (Bovine) (see paper)
55% identity, 98% coverage: 9:396/397 of query aligns to 31:418/419 of Q0P5L8
Sites not aligning to the query:
7poaA An irreversible, promiscuous and highly thermostable claisen- condensation biocatalyst drives the synthesis of substituted pyrroles
41% identity, 99% coverage: 4:396/397 of query aligns to 7:397/398 of 7poaA
3a2bA Crystal structure of serine palmitoyltransferase from sphingobacterium multivorum with substrate l-serine (see paper)
36% identity, 95% coverage: 17:392/397 of query aligns to 19:391/392 of 3a2bA
8h29A Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-threonine (see paper)
36% identity, 95% coverage: 17:392/397 of query aligns to 19:391/394 of 8h29A
8h21A Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-alanine (see paper)
36% identity, 95% coverage: 17:392/397 of query aligns to 19:391/394 of 8h21A
8h20A Serine palmitoyltransferase from sphingobacterium multivorum complexed with glycine (see paper)
36% identity, 95% coverage: 17:392/397 of query aligns to 19:391/394 of 8h20A
8h1yA Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-homoserine (see paper)
36% identity, 95% coverage: 17:392/397 of query aligns to 19:391/394 of 8h1yA
8h1qA Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-serine (see paper)
36% identity, 95% coverage: 17:392/397 of query aligns to 19:391/394 of 8h1qA
8guhA Serine palmitoyltransferase from sphingobacterium multivorum complexed with tris (see paper)
36% identity, 95% coverage: 17:392/397 of query aligns to 19:391/394 of 8guhA
Q5W264 4-hydroxy-2,2'-bipyrrole-5-methanol synthase PigH; HBM synthase; Aminotransferase PigH; EC 2.3.2.- from Serratia sp. (strain ATCC 39006) (see paper)
37% identity, 89% coverage: 42:395/397 of query aligns to 286:636/653 of Q5W264
Sites not aligning to the query:
Q93UV0 Serine palmitoyltransferase; SPT; EC 2.3.1.50 from Sphingomonas paucimobilis (Pseudomonas paucimobilis) (see 4 papers)
36% identity, 90% coverage: 40:396/397 of query aligns to 64:419/420 of Q93UV0
Sites not aligning to the query:
2xbnA Inhibition of the plp-dependent enzyme serine palmitoyltransferase by cycloserine: evidence for a novel decarboxylative mechanism of inactivation (see paper)
36% identity, 90% coverage: 40:396/397 of query aligns to 43:398/398 of 2xbnA
2w8jA Spt with plp-ser (see paper)
36% identity, 90% coverage: 40:396/397 of query aligns to 43:398/398 of 2w8jA
>BWI76_RS27255 FitnessBrowser__Koxy:BWI76_RS27255
MRGDFYKQLTNDLDTARAEGLFKEERIITSAQQADITVGGSQVINFCANNYLGLANHPEL
IAAAKSGMDSHGFGMASVRFICGTQDSHKALEKKLADFLGMEDAILYSSCFDANGGLFET
LLGAEDAIISDALNHASIIDGVRLCKAKRFRYANNDMVELEARLKEARDAGARHVLIATD
GVFSMDGVIANLKGVCDLADKYDALVMVDDSHAVGFVGENGRGSHEYCDVMGRVDIITGT
LGKALGGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLEMVEAGSELRDR
LWSNARLFREKMTAAGFILAGADHAIIPVMLGEATVAQEFARELQKEGIYVTGFFYPVVP
KGQARIRTQMSAAHTPEQIERAVEAFTRIGKQLGVIA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory