Comparing BWI76_RS27465 FitnessBrowser__Koxy:BWI76_RS27465 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4mvaA 1.43 angstrom resolution crystal structure of triosephosphate isomerase (tpia) from escherichia coli in complex with acetyl phosphate. (see paper)
93% identity, 100% coverage: 1:255/255 of query aligns to 1:255/255 of 4mvaA
B1XB85 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Escherichia coli (strain K12 / DH10B) (see paper)
93% identity, 100% coverage: 1:255/255 of query aligns to 1:255/255 of B1XB85
P50921 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Moritella marina (Vibrio marinus) (see paper)
66% identity, 93% coverage: 1:237/255 of query aligns to 1:239/256 of P50921
1aw1A Triosephosphate isomerase of vibrio marinus complexed with 2- phosphoglycolate (see paper)
66% identity, 93% coverage: 2:237/255 of query aligns to 1:238/255 of 1aw1A
6neeB Crystal structure of a reconstructed ancestor of triosephosphate isomerase from eukaryotes (see paper)
51% identity, 98% coverage: 2:250/255 of query aligns to 4:252/252 of 6neeB
6oogA Crystal structure of triosephosphate isomerase from taenia solium in complex with 2pg (see paper)
50% identity, 96% coverage: 2:245/255 of query aligns to 5:248/252 of 6oogA
6ooiC Crystal structure of triosephosphate isomerase from schistosoma mansoni in complex with 2pg (see paper)
49% identity, 98% coverage: 2:250/255 of query aligns to 8:255/255 of 6ooiC
P00942 Triosephosphate isomerase; TIM; Triose-phosphate isomerase; EC 5.3.1.1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
46% identity, 96% coverage: 2:245/255 of query aligns to 3:244/248 of P00942
Sites not aligning to the query:
3ypiA Electrophilic catalysis in triosephosphase isomerase: the role of histidine-95 (see paper)
46% identity, 96% coverage: 2:245/255 of query aligns to 2:243/247 of 3ypiA
4ff7B Structure of c126s mutant of saccharomyces cerevisiae triosephosphate isomerase (see paper)
46% identity, 96% coverage: 2:245/255 of query aligns to 2:243/247 of 4ff7B
4ff7A Structure of c126s mutant of saccharomyces cerevisiae triosephosphate isomerase (see paper)
46% identity, 96% coverage: 2:245/255 of query aligns to 2:243/247 of 4ff7A
4y96A Crystal structure of triosephosphate isomerase from gemmata obscuriglobus (see paper)
47% identity, 97% coverage: 2:249/255 of query aligns to 2:249/250 of 4y96A
5zfxB Crystal structure of triosephosphate isomerase from opisthorchis viverrini (see paper)
47% identity, 94% coverage: 2:240/255 of query aligns to 1:239/248 of 5zfxB
P07669 Triosephosphate isomerase; TIM; Triose-phosphate isomerase; EC 5.3.1.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
48% identity, 96% coverage: 2:245/255 of query aligns to 3:244/249 of P07669
P36204 Bifunctional PGK/TIM; EC 2.7.2.3; EC 5.3.1.1 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
45% identity, 93% coverage: 2:238/255 of query aligns to 402:639/654 of P36204
Sites not aligning to the query:
3uwvA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with 2-phosphoglyceric acid (see paper)
43% identity, 98% coverage: 1:250/255 of query aligns to 3:255/255 of 3uwvA
3uwzA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with glycerol-2-phosphate (see paper)
43% identity, 98% coverage: 1:250/255 of query aligns to 2:254/254 of 3uwzA
3uwwA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with 3-phosphoglyceric acid (see paper)
43% identity, 98% coverage: 1:250/255 of query aligns to 2:254/254 of 3uwwA
3uwuA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with glycerol-3-phosphate (see paper)
43% identity, 98% coverage: 1:250/255 of query aligns to 1:253/253 of 3uwuA
Q6GIL6 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Staphylococcus aureus (strain MRSA252) (see paper)
43% identity, 98% coverage: 1:250/255 of query aligns to 1:253/253 of Q6GIL6
>BWI76_RS27465 FitnessBrowser__Koxy:BWI76_RS27465
MRHPLVMGNWKLNGSRHMVNELVANLRTELAGVTGCAVAIAPPEMYIDLAKQAAAGSHIH
LGAQNVDLNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LIPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGVVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKADAKVAEQVIIQYGGSVNAGNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAEAAKKA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory