SitesBLAST
Comparing BWI76_RS27485 FitnessBrowser__Koxy:BWI76_RS27485 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
93% identity, 100% coverage: 1:319/319 of query aligns to 1:319/319 of Q8ZKR2
- D16 (= D16) binding
- G31 (= G31) binding
- Y101 (= Y101) binding
- R162 (= R162) binding
- A180 (= A180) binding
- A181 (= A181) binding
- A183 (= A183) binding
- G213 (= G213) binding
- D246 (= D246) binding
- T248 (= T248) binding
- D252 (= D252) binding
- A287 (= A287) binding
- A290 (= A290) binding
- G292 (= G292) binding
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
91% identity, 96% coverage: 5:310/319 of query aligns to 1:299/299 of 1tz3A
- active site: C24 (= C28), F88 (= F99), G238 (= G249), A239 (= A250), G240 (= G251), D241 (= D252)
- binding 5-aminoimidazole ribonucleoside: D8 (= D12), S10 (= S14), D12 (= D16), G27 (= G31), L83 (= L87), F88 (= F99), Y90 (= Y101), R151 (= R162), M154 (= M165), D241 (= D252)
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
91% identity, 95% coverage: 5:308/319 of query aligns to 1:297/297 of 1tz6A
- active site: C24 (= C28), F88 (= F99), G238 (= G249), A239 (= A250), G240 (= G251), D241 (= D252)
- binding phosphomethylphosphonic acid adenylate ester: N149 (= N160), K176 (= K187), E181 (= E192), S209 (= S220), G211 (= G222), A212 (= A223), G214 (= G225), A239 (= A250), G240 (= G251), F243 (= F254), N270 (= N281), G273 (= G284), A274 (= A285)
- binding 5-aminoimidazole ribonucleoside: D8 (= D12), D12 (= D16), G27 (= G31), F88 (= F99), Y90 (= Y101), R151 (= R162), M154 (= M165), D241 (= D252)
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
43% identity, 95% coverage: 4:307/319 of query aligns to 1:305/306 of 5eynA
- active site: G246 (= G249), A247 (= A250), G248 (= G251), D249 (= D252)
- binding adenosine-5'-diphosphate: H91 (≠ D94), T217 (≠ S220), G219 (= G222), A220 (= A223), A238 (≠ R241), V239 (= V242), T244 (= T247), G246 (= G249), A247 (= A250), G248 (= G251), F251 (= F254), N279 (= N281), G282 (= G284), A283 (= A285)
- binding beryllium trifluoride ion: G246 (= G249), G248 (= G251), D249 (= D252)
- binding beta-D-fructofuranose: D9 (= D12), D13 (= D16), G28 (= G31), A29 (= A32), N32 (= N35), F96 (= F99), F98 (≠ Y101), R159 (= R162), D249 (= D252)
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
43% identity, 96% coverage: 2:307/319 of query aligns to 3:309/310 of 5yggA
- binding adenosine-5'-diphosphate: K188 (= K187), T221 (≠ S220), G223 (= G222), A242 (≠ R241), V243 (= V242), F255 (= F254), N283 (= N281), G286 (= G284), A287 (= A285)
- binding beta-D-fructofuranose: D13 (= D12), D17 (= D16), G32 (= G31), A33 (= A32), F100 (= F99), F102 (≠ Y101), R163 (= R162), D253 (= D252)
3lkiB Crystal structure of fructokinase with bound atp from xylella fastidiosa
34% identity, 96% coverage: 5:311/319 of query aligns to 3:321/322 of 3lkiB
8cqxA Ribokinase from t.Sp mutant a92g
31% identity, 89% coverage: 25:307/319 of query aligns to 31:298/300 of 8cqxA
- binding adenosine-5'-diphosphate: N179 (≠ C186), T217 (≠ S220), G219 (= G222), A220 (= A223), G222 (= G225), F250 (= F254), N272 (= N281), G275 (= G284), A276 (= A285), T279 (≠ V288)
- binding magnesium ion: D242 (= D246), T244 (= T248), A278 (= A287), S287 (≠ A296)
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
27% identity, 96% coverage: 7:312/319 of query aligns to 2:301/302 of 3gbuA
- active site: G242 (= G249), A243 (= A250), G244 (= G251), D245 (= D252)
- binding adenosine-5'-triphosphate: K188 (= K187), T213 (≠ S220), G215 (= G222), V235 (= V242), P237 (≠ V244), A243 (= A250), G244 (= G251), A274 (≠ G284)
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
27% identity, 96% coverage: 7:312/319 of query aligns to 3:302/304 of 3ih0A
6znxC Ribokinase from thermus species
31% identity, 94% coverage: 7:307/319 of query aligns to 2:263/265 of 6znxC
3iq0B Crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.Coli
28% identity, 96% coverage: 4:310/319 of query aligns to 1:308/308 of 3iq0B
- active site: G252 (= G249), A253 (= A250), G254 (= G251), D255 (= D252)
- binding adenosine-5'-triphosphate: S192 (= S189), K223 (≠ S220), G225 (= G222), E247 (≠ V244), A253 (= A250), G254 (= G251), F257 (= F254), N279 (= N281), G282 (= G284)
Q9M394 Fructokinase-like 1, chloroplastic; PEP-associated protein 6; pfkB-type carbohydrate kinase family protein 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
25% identity, 85% coverage: 27:298/319 of query aligns to 145:453/471 of Q9M394
Sites not aligning to the query:
- 105 C→A: Does not affect the interaction with CITRX.
- 105:106 CC→AA: Abolishes interaction with CITRX.
- 106 C→A: Strongly reduces the interaction with CITRX.
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
26% identity, 97% coverage: 4:311/319 of query aligns to 1:306/306 of 4xckA
- active site: A249 (≠ G249), A250 (= A250), G251 (= G251), D252 (= D252)
- binding adenosine-5'-diphosphate: T220 (≠ S220), G222 (= G222), S223 (≠ A223), V242 (= V242), T247 (= T247), A250 (= A250), F254 (= F254), H276 (≠ N281), A279 (≠ G284), V283 (= V288)
- binding alpha-D-ribofuranose: N11 (≠ S14), D13 (= D16), G39 (= G31), K40 (≠ A32), N43 (= N35), A95 (≠ L87), I107 (≠ F99), I109 (≠ Y101), E140 (= E139), T248 (= T248), D252 (= D252)
P0A9J6 Ribokinase; RK; EC 2.7.1.15 from Escherichia coli (strain K12) (see 3 papers)
28% identity, 89% coverage: 23:307/319 of query aligns to 34:305/309 of P0A9J6
Sites not aligning to the query:
1rk2A E. Coli ribokinase complexed with ribose and adp, solved in space group p212121 (see paper)
28% identity, 89% coverage: 23:307/319 of query aligns to 31:302/305 of 1rk2A
- active site: A249 (≠ G249), A250 (= A250), G251 (= G251), D252 (= D252)
- binding adenosine-5'-diphosphate: T220 (≠ S220), G222 (= G222), S223 (≠ A223), A250 (= A250), G251 (= G251), H276 (≠ N281), A279 (≠ G284)
- binding tetrafluoroaluminate ion: G213 (= G213), R215 (≠ D215)
- binding magnesium ion: D246 (= D246), A282 (= A287), R285 (≠ A290), S291 (≠ A296)
- binding alpha-D-ribofuranose: G38 (= G30), G39 (= G31), K40 (≠ A32), N43 (= N35), E140 (≠ D134), D252 (= D252)
Sites not aligning to the query:
1gqtB Activation of ribokinase by monovalent cations (see paper)
28% identity, 89% coverage: 23:307/319 of query aligns to 33:304/307 of 1gqtB
- active site: A251 (≠ G249), A252 (= A250), G253 (= G251), D254 (= D252)
- binding phosphomethylphosphonic acid adenylate ester: N186 (≠ S189), T222 (≠ S220), G224 (= G222), S225 (≠ A223), A252 (= A250), G253 (= G251), H278 (≠ N281), A281 (≠ G284)
- binding cesium ion: D248 (= D246), I250 (≠ T248), A284 (= A287), R287 (≠ A290), S293 (≠ A296)
- binding alpha-D-ribofuranose: G41 (= G31), N45 (= N35), E142 (≠ D134), D254 (= D252)
Sites not aligning to the query:
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
28% identity, 96% coverage: 4:309/319 of query aligns to 1:303/309 of Q53W83
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
29% identity, 95% coverage: 4:307/319 of query aligns to 1:301/301 of 1v1aA
- active site: G248 (= G249), A249 (= A250), G250 (= G251), D251 (= D252)
- binding adenosine-5'-diphosphate: K219 (≠ S220), G221 (= G222), A222 (= A223), A249 (= A250), G250 (= G251), N275 (= N281), A279 (= A285)
- binding 2-keto-3-deoxygluconate: L11 (≠ S14), G34 (= G31), A35 (= A32), N38 (= N35), Y89 (≠ V86), R105 (vs. gap), R167 (= R162), G248 (= G249), D251 (= D252), D287 (≠ A293)
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
28% identity, 95% coverage: 4:306/319 of query aligns to 1:300/300 of 1v1bA
- active site: G248 (= G249), A249 (= A250), G250 (= G251), D251 (= D252)
- binding adenosine-5'-triphosphate: K219 (≠ S220), G221 (= G222), A238 (= A239), F239 (≠ P240), V241 (= V242), G248 (= G249), A249 (= A250), G250 (= G251), N275 (= N281), A279 (= A285)
4wjmA Crystal structure of fructokinase from brucella abortus 2308 with bound amppnp
27% identity, 92% coverage: 11:303/319 of query aligns to 12:312/312 of 4wjmA
- active site: G252 (= G249), A253 (= A250), G254 (= G251), D255 (= D252)
- binding phosphoaminophosphonic acid-adenylate ester: T223 (≠ S220), G225 (= G222), A226 (= A223), G228 (= G225), G252 (= G249), A253 (= A250), G254 (= G251), V257 (≠ F254), V292 (vs. gap), A295 (≠ M286)
Query Sequence
>BWI76_RS27485 FitnessBrowser__Koxy:BWI76_RS27485
MNAMNKVWAIGDASVDLVPEKQNSYLKCPGGASANVGVCVARLGGTCGFIGCLGDDDAGR
FLRQVFQDNGVDVSSLRLDASLTSAVLIVNLTADGERSFTYLVHPGADTYVSPQDLPTFR
KYEWFYFSSIGLTDSPAREACLEGARRMREAGGYVLFDVNLRSKMWRNTAEIPDLIARSA
ALASICKVSADELCQLSGASHWQDARYYMRDLGCDTTIISLGAEGALLITAEGEFLFPAP
RVEVVDTTGAGDAFVGGLLFTLSRENYWNHALLAEAISNANACGAMAVTAKGAMTALPYP
DQLNTFLSSRSLAQAMTVK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory