Comparing BWI76_RS27510 FitnessBrowser__Koxy:BWI76_RS27510 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AER0 Glycerol uptake facilitator protein; Aquaglyceroporin; Glycerol facilitator from Escherichia coli (strain K12) (see 3 papers)
90% identity, 100% coverage: 1:283/283 of query aligns to 1:281/281 of P0AER0
1fx8A Crystal structure of the e. Coli glycerol facilitator (glpf) with substrate glycerol (see paper)
92% identity, 90% coverage: 6:259/283 of query aligns to 1:254/254 of 1fx8A
B1VB61 Propanediol uptake facilitator PduF from Citrobacter freundii (see paper)
70% identity, 95% coverage: 3:271/283 of query aligns to 1:269/269 of B1VB61
P37451 Propanediol uptake facilitator PduF from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
70% identity, 93% coverage: 3:264/283 of query aligns to 1:262/264 of P37451
Q96PS8 Aquaporin-10; AQP-10; Aquaglyceroporin-10; Small intestine aquaporin from Homo sapiens (Human) (see 2 papers)
38% identity, 98% coverage: 5:282/283 of query aligns to 18:286/301 of Q96PS8
O14520 Aquaporin-7; AQP-7; Aquaglyceroporin-7; Aquaporin adipose; AQPap; Aquaporin-7-like from Homo sapiens (Human) (see 4 papers)
35% identity, 93% coverage: 10:271/283 of query aligns to 36:292/342 of O14520
Sites not aligning to the query:
6f7hC Crystal structure of human aqp10 (see paper)
38% identity, 90% coverage: 5:258/283 of query aligns to 3:252/253 of 6f7hC
8c9hA Aqp7_inhibitor
36% identity, 87% coverage: 10:256/283 of query aligns to 11:252/253 of 8c9hA
6n1gA Crystal structure of aquaglyceroporin aqp7 (see paper)
36% identity, 87% coverage: 10:256/283 of query aligns to 5:246/249 of 6n1gA
I1CR68 Aquaporin-1 from Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) (Mucormycosis agent) (Rhizopus arrhizus var. delemar) (see paper)
38% identity, 87% coverage: 2:247/283 of query aligns to 49:292/306 of I1CR68
3c02A X-ray structure of the aquaglyceroporin from plasmodium falciparum (see paper)
38% identity, 87% coverage: 10:255/283 of query aligns to 5:235/242 of 3c02A
2evuA Crystal structure of aquaporin aqpm at 2.3a resolution (see paper)
34% identity, 88% coverage: 6:254/283 of query aligns to 3:243/245 of 2evuA
P08995 Nodulin-26; N-26 from Glycine max (Soybean) (Glycine hispida) (see paper)
33% identity, 93% coverage: 10:273/283 of query aligns to 39:262/271 of P08995
Q6Z2T3 Aquaporin NIP2-1; Low silicon protein 1; NOD26-like intrinsic protein 2-1; OsNIP2;1; Silicon influx transporter LSI1 from Oryza sativa subsp. japonica (Rice) (see paper)
30% identity, 72% coverage: 7:210/283 of query aligns to 47:226/298 of Q6Z2T3
Q9SAI4 Aquaporin NIP6-1; NOD26-like intrinsic protein 6-1; AtNIP6;1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 92% coverage: 13:271/283 of query aligns to 84:302/305 of Q9SAI4
Q08733 Aquaporin PIP1-3; AtPIP1;3; Plasma membrane intrinsic protein 1c; PIP1c; Transmembrane protein B; TMP-B from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 88% coverage: 12:260/283 of query aligns to 55:281/286 of Q08733
Sites not aligning to the query:
P56402 Aquaporin-2; AQP-2; ADH water channel; Aquaporin-CD; AQP-CD; Collecting duct water channel protein; WCH-CD; Water channel protein for renal collecting duct from Mus musculus (Mouse) (see 2 papers)
31% identity, 86% coverage: 12:255/283 of query aligns to 14:223/271 of P56402
Sites not aligning to the query:
P41181 Aquaporin-2; AQP-2; ADH water channel; Aquaporin-CD; AQP-CD; Collecting duct water channel protein; WCH-CD; Water channel protein for renal collecting duct from Homo sapiens (Human) (see 12 papers)
32% identity, 86% coverage: 13:255/283 of query aligns to 15:223/271 of P41181
Sites not aligning to the query:
3nkaA Crystal structure of aqpz h174g,t183f (see paper)
33% identity, 70% coverage: 10:207/283 of query aligns to 6:192/230 of 3nkaA
4nefA X-ray structure of human aquaporin 2 (see paper)
32% identity, 86% coverage: 13:255/283 of query aligns to 14:222/239 of 4nefA
>BWI76_RS27510 FitnessBrowser__Koxy:BWI76_RS27510
MSQTSTLKGQCIAEFLGTGLLIFFGVGCVAALKVAGASFGQWEISIIWGLGVAMAIYLTA
GVSGAHLNPAVTIALWLFACFDGRKVVPFIIAQFAGAFCAAALVYGLYYNLFFDFEHTHN
MVRGSVESLELAGIFSTYPNPHINFVQAFAVEMVITAILMGVILALTDDGNGVPRGPLAP
LLIGLLIAVIGASMGPLTGFAMNPARDIGPKAFAWLAGWGNVAFTGGKDIPYFLVPLCAP
IVGAALGAFCYRKLIGRHLPCDTCVVEEKEAASPSTTQHKASL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory