Comparing BWI76_RS27540 FitnessBrowser__Koxy:BWI76_RS27540 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
5c3mB Crystal structure of gan4c, a gh4 6-phospho-glucosidase from geobacillus stearothermophilus
28% identity, 98% coverage: 1:451/459 of query aligns to 1:401/411 of 5c3mB
1up7A Structure of the 6-phospho-beta glucosidase from thermotoga maritima at 2.4 angstrom resolution in the tetragonal form with NAD and glucose-6-phosphate (see paper)
28% identity, 98% coverage: 1:451/459 of query aligns to 3:405/414 of 1up7A
1up6A Structure of the 6-phospho-beta glucosidase from thermotoga maritima at 2.55 angstrom resolution in the tetragonal form with manganese, NAD+ and glucose-6-phosphate (see paper)
28% identity, 98% coverage: 1:451/459 of query aligns to 2:404/413 of 1up6A
6wbtA 2.52 angstrom resolution crystal structure of 6-phospho-alpha- glucosidase from gut microorganisms in complex with NAD and glucose- 6-phosphate
26% identity, 98% coverage: 1:451/459 of query aligns to 4:432/442 of 6wbtA
6dvvA 2.25 angstrom resolution crystal structure of 6-phospho-alpha- glucosidase from klebsiella pneumoniae in complex with NAD and mn2+. (see paper)
26% identity, 97% coverage: 3:447/459 of query aligns to 6:421/435 of 6dvvA
6vc6B 2.1 angstrom resolution crystal structure of 6-phospho-alpha- glucosidase from gut microorganisms in complex with NAD and mn2+
23% identity, 98% coverage: 3:451/459 of query aligns to 5:430/440 of 6vc6B
1u8xX Crystal structure of glva from bacillus subtilis, a metal-requiring, NAD-dependent 6-phospho-alpha-glucosidase (see paper)
26% identity, 85% coverage: 58:447/459 of query aligns to 61:419/436 of 1u8xX
Sites not aligning to the query:
Q97LM4 Maltose-6'-phosphate glucosidase MalH; 6-phospho-alpha-glucosidase; 6-phospho-glucosidase; Maltose-6-phosphate hydrolase; EC 3.2.1.122 from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) (see paper)
25% identity, 98% coverage: 3:451/459 of query aligns to 6:431/441 of Q97LM4
P54716 Maltose-6'-phosphate glucosidase; 6-phospho-alpha-D-glucosidase; 6-phosphoryl-O-alpha-D-glucopyranosyl:phosphoglucohydrolase; EC 3.2.1.122 from Bacillus subtilis (strain 168) (see paper)
26% identity, 85% coverage: 58:447/459 of query aligns to 63:428/449 of P54716
Sites not aligning to the query:
Q9AI65 Alpha-glucosidase; EC 3.2.1.20 from Erwinia rhapontici (Pectobacterium rhapontici) (see paper)
25% identity, 43% coverage: 2:199/459 of query aligns to 4:203/453 of Q9AI65
Sites not aligning to the query:
P39130 Alpha-galacturonidase; EC 3.2.1.67 from Bacillus subtilis (strain 168) (see paper)
23% identity, 72% coverage: 106:436/459 of query aligns to 113:425/446 of P39130
3fefA Crystal structure of putative glucosidase lpld from bacillus subtilis
23% identity, 72% coverage: 106:436/459 of query aligns to 107:419/434 of 3fefA
>BWI76_RS27540 FitnessBrowser__Koxy:BWI76_RS27540
MKLTVLGGGGVRSAFLAKSLAYNAHRIGLTEVVFLDSSAENLAIFGEIARYVFNAIRPDI
HFSVTSDPVPALKNSHYVITTLRVGGDESRIRDERIALEHNTLGQETTGAGGFAMAMRSI
PAILNYCRLIEEHAAEDAILFNFTNPSGLVTEAIIKSGFKRRVYGICDAPSELIRELPAI
LGCDERDLGVECYGLNHFSWFTHFTVRGEDVTERLIASPDLYRKTAMQYFSPELVQLCDK
QLLNEYLYYYYYREVALKAIQNAPETRGEQIARINHDMREELRTVDVKANPEAAFTLWMK
HYLRRENSYMQNESQQEKFHTREPLTLKQFIEEPDTGGYAGVALDILEAVNSTATKRIVV
SMSNNGTLDFLRPDDVIEISCDLSKDGLKPVTPKHVPTAQKNMIASVKEYERLAVAAILQ
RDKSLAVRALMAHPLVGSYSLAKTLVEAYLDDKQFADWQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory