SitesBLAST
Comparing BWI76_RS27560 FitnessBrowser__Koxy:BWI76_RS27560 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1rv8B Class ii fructose-1,6-bisphosphate aldolase from thermus aquaticus in complex with cobalt (see paper)
40% identity, 99% coverage: 1:283/286 of query aligns to 1:305/305 of 1rv8B
- active site: D80 (= D80), H81 (= H81), E140 (≠ G140), H178 (= H178), H208 (= H208), N251 (= N230)
- binding cobalt (ii) ion: H81 (= H81), E132 (= E132), H178 (= H178), H208 (= H208)
- binding sulfate ion: R116 (= R116), H123 (= H123), S211 (= S211), D253 (≠ S232), T254 (≠ S233)
P13243 Probable fructose-bisphosphate aldolase; FBP aldolase; FBPA; Fructose-1,6-bisphosphate aldolase; EC 4.1.2.13 from Bacillus subtilis (strain 168) (see paper)
40% identity, 99% coverage: 2:283/286 of query aligns to 3:285/285 of P13243
- T212 (≠ S211) modified: Phosphothreonine
- T234 (≠ S233) modified: Phosphothreonine
4to8A Methicillin-resistant staphylococcus aureus class iib fructose 1,6- bisphosphate aldolase (see paper)
35% identity, 99% coverage: 2:284/286 of query aligns to 2:278/279 of 4to8A
8q59A Crystal structure of metal-dependent class ii sulfofructose phosphate aldolase from yersinia aldovae in complex with sulfofructose phosphate (yasqia-zn-sfp) (see paper)
37% identity, 99% coverage: 3:286/286 of query aligns to 4:279/280 of 8q59A
- binding (3~{S},4~{S})-2,3,4-tris(oxidanyl)-5-oxidanylidene-6-phosphonooxy-hexane-1-sulfonic acid: G50 (≠ H49), Q51 (≠ P50), K52 (≠ S51), D82 (= D80), H83 (= H81), H172 (= H178), G173 (= G179), H200 (= H208), G201 (= G209), S203 (= S211), N222 (= N230), D224 (≠ S232), T225 (≠ S233)
- binding zinc ion: H83 (= H81), H172 (= H178), H200 (= H208)
3q94A The crystal structure of fructose 1,6-bisphosphate aldolase from bacillus anthracis str. 'Ames ancestor'
39% identity, 99% coverage: 2:283/286 of query aligns to 3:285/285 of 3q94A
- active site: D85 (= D80), H86 (= H81), E145 (≠ G140), H181 (= H178), H209 (= H208), N231 (= N230)
- binding zinc ion: H86 (= H81), E114 (= E109), H163 (≠ D160), H181 (= H178), H209 (= H208), E235 (≠ D234), E239 (≠ A238)
8q5aA Crystal structure of metal-dependent class ii sulfofructosephosphate aldolase from hafnia paralvei hpsqia-zn in complex with dihydroxyacetone phosphate (dhap) (see paper)
37% identity, 98% coverage: 3:283/286 of query aligns to 4:276/276 of 8q5aA
P0AB74 D-tagatose-1,6-bisphosphate aldolase subunit KbaY; TBPA; TagBP aldolase; D-tagatose-bisphosphate aldolase class II; Ketose 1,6-bisphosphate aldolase class II; Tagatose-bisphosphate aldolase; EC 4.1.2.40 from Escherichia coli (strain K12) (see paper)
34% identity, 99% coverage: 2:284/286 of query aligns to 3:285/286 of P0AB74
- D82 (= D80) active site, Proton donor
- H83 (= H81) binding
- H180 (= H178) binding
- H208 (= H208) binding
3n9sA Class ii fructose-1,6-bisphosphate aldolase from helicobacter pylori in complex with n-(4-hydroxybutyl)- glycolohydroxamic acid bis- phosphate, a competitive inhibitor (see paper)
33% identity, 99% coverage: 1:282/286 of query aligns to 1:306/307 of 3n9sA
- active site: C69 (≠ T68), E70 (≠ Q69), G136 (= G134), H180 (= H178), A226 (vs. gap), N253 (= N230)
- binding calcium ion: D104 (= D102), S106 (= S104), E134 (= E132)
- binding 4-{hydroxy[(phosphonooxy)acetyl]amino}butyl dihydrogen phosphate: N23 (= N23), S49 (≠ H49), D82 (= D80), H83 (= H81), H180 (= H178), G181 (= G179), K184 (≠ P182), H210 (= H208), G211 (= G209), S213 (= S211), N253 (= N230), D255 (≠ S232), T256 (≠ S233)
- binding zinc ion: H83 (= H81), H180 (= H178), H210 (= H208)
1gvfB Structure of tagatose-1,6-bisphosphate aldolase (see paper)
35% identity, 98% coverage: 2:282/286 of query aligns to 2:274/275 of 1gvfB
- active site: D81 (= D80), H82 (= H81), H171 (= H178), H199 (= H208), N221 (= N230)
- binding phosphoglycolohydroxamic acid: D81 (= D80), H82 (= H81), H171 (= H178), G172 (= G179), H199 (= H208), G200 (= G209), S202 (= S211), N221 (= N230), V222 (≠ I231), A223 (≠ S232), T224 (≠ S233)
- binding zinc ion: H82 (= H81), H171 (= H178), H199 (= H208)
3n9rA Class ii fructose-1,6-bisphosphate aldolase from helicobacter pylori in complex with n-(4-hydroxybutyl)-phosphoglycolohydroxamic acid, a competitive inhibitor (see paper)
34% identity, 99% coverage: 1:282/286 of query aligns to 1:296/297 of 3n9rA
- active site: C69 (≠ T68), E70 (≠ Q69), G136 (= G134), H170 (= H178), A216 (vs. gap), N243 (= N230)
- binding 2-[hydroxy(4-hydroxybutyl)amino]-2-oxoethyl dihydrogen phosphate: H83 (= H81), H170 (= H178), G171 (= G179), K174 (≠ P182), H200 (= H208), G201 (= G209), S203 (= S211), N243 (= N230), D245 (≠ S232), T246 (≠ S233)
- binding zinc ion: H83 (= H81), H170 (= H178), H200 (= H208)
3c56A Class ii fructose-1,6-bisphosphate aldolase from helicobacter pylori in complex with n-(3-hydroxypropyl)-glycolohydroxamic acid bisphosphate, a competitive inhibitor (see paper)
34% identity, 99% coverage: 1:282/286 of query aligns to 1:296/297 of 3c56A
- active site: C69 (≠ T68), E70 (≠ Q69), G136 (= G134), H170 (= H178), A216 (vs. gap), N243 (= N230)
- binding 3-{hydroxy[(phosphonooxy)acetyl]amino}propyl dihydrogen phosphate: N23 (= N23), S49 (≠ H49), D82 (= D80), H170 (= H178), K174 (≠ P182), G201 (= G209), S203 (= S211), N243 (= N230), D245 (≠ S232), T246 (≠ S233), R249 (≠ K236)
- binding zinc ion: H83 (= H81), H170 (= H178), H200 (= H208)
3c52A Class ii fructose-1,6-bisphosphate aldolase from helicobacter pylori in complex with phosphoglycolohydroxamic acid, a competitive inhibitor (see paper)
33% identity, 99% coverage: 1:282/286 of query aligns to 1:295/296 of 3c52A
- active site: C69 (≠ T68), E70 (≠ Q69), G136 (= G134), H169 (= H178), A215 (vs. gap), N242 (= N230)
- binding calcium ion: D104 (= D102), S106 (= S104), E134 (= E132)
- binding phosphoglycolohydroxamic acid: D82 (= D80), H83 (= H81), H169 (= H178), K173 (≠ P182), H199 (= H208), G200 (= G209), S202 (= S211), N242 (= N230), D244 (≠ S232), T245 (≠ S233)
- binding zinc ion: H83 (= H81), H169 (= H178), H199 (= H208)
5ucpA Class ii fructose-1,6-bisphosphate aldolase e142a variant of helicobacter pylori with fbp and cleavage products (see paper)
33% identity, 99% coverage: 1:282/286 of query aligns to 1:291/292 of 5ucpA
- binding 1,6-di-O-phosphono-D-fructose: S49 (≠ H49), D82 (= D80), H83 (= H81), H165 (= H178), K169 (≠ P182), G196 (= G209), S198 (= S211), N238 (= N230), D240 (≠ S232), T241 (≠ S233), R244 (≠ K236)
- binding zinc ion: H83 (= H81), H83 (= H81), H83 (= H81), E134 (= E132), H165 (= H178), H165 (= H178), H165 (= H178), H195 (= H208), H195 (= H208)
5uckA Class ii fructose-1,6-bisphosphate aldolase of helicobacter pylori with cleavage products (see paper)
33% identity, 99% coverage: 1:282/286 of query aligns to 1:290/291 of 5uckA
- binding glyceraldehyde-3-phosphate: S49 (≠ H49), D82 (= D80), H83 (= H81), H164 (= H178), D239 (≠ S232), R243 (≠ K236)
- binding zinc ion: H83 (= H81), H83 (= H81), E134 (= E132), H164 (= H178), H194 (= H208), H194 (= H208)
5ud4A Class ii fructose-1,6-bisphosphate aldolase h180q variant of helicobacter pylori with tbp (see paper)
33% identity, 99% coverage: 1:282/286 of query aligns to 1:292/293 of 5ud4A
- binding 1,6-di-O-phosphono-D-tagatose: S49 (≠ H49), D82 (= D80), Q166 (≠ H178), G167 (= G179), K170 (≠ P182), G197 (= G209), S199 (= S211), N239 (= N230), D241 (≠ S232), T242 (≠ S233), R245 (≠ K236)
- binding zinc ion: H83 (= H81), H83 (= H81), E134 (= E132), H196 (= H208), H196 (= H208)
6ofuB X-ray crystal structure of the ydji aldolase from escherichia coli k12 (see paper)
37% identity, 95% coverage: 12:283/286 of query aligns to 13:263/264 of 6ofuB
A8B2U2 Fructose-bisphosphate aldolase; Glfba; glFBPA; Fructose-1,6-bisphosphate aldolase; EC 4.1.2.13 from Giardia intestinalis (strain ATCC 50803 / WB clone C6) (Giardia lamblia) (see 4 papers)
34% identity, 100% coverage: 2:286/286 of query aligns to 3:310/323 of A8B2U2
- S50 (≠ H49) binding
- D83 (= D80) active site, Proton donor; mutation to A: Severe loss of catalytic activity.
- H84 (= H81) binding
- H178 (= H178) binding ; binding
- G179 (= G179) binding
- K182 (≠ P182) binding
- H210 (= H208) binding
- G211 (= G209) binding
- S213 (vs. gap) binding
- N253 (= N230) binding
- D255 (≠ S232) binding ; mutation to A: 9.4-fold reduction in substrate affinity and 50-fold reduction in catalytic affinity. Has some activity towards tagatose-1,6-bisphosphate.
- S256 (= S233) binding
- R259 (≠ K236) binding ; mutation to A: 1.8-fold reduction in substrate affinity and 2.8-fold reduction in catalytic efficiency. 6-fold reduction in substrate affinity and 24-fold reduction in catalytic efficiency; when associated with A-278.
- D278 (= D254) mutation to A: 159-fold reduction in substrate affinity and 2770-fold reduction in catalytic efficiency. 6-fold reduction in substrate affinity and 24-fold reduction in catalytic efficiency; when associated with A-259.
- R280 (≠ N256) binding
5ud0A Class ii fructose-1,6-bisphosphate aldolase e149a variant of helicobacter pylori with cleavage products (see paper)
33% identity, 99% coverage: 1:282/286 of query aligns to 1:281/282 of 5ud0A
3gayA Structure of giardia fructose-1,6-biphosphate aldolase in complex with tagatose-1,6-biphosphate (see paper)
34% identity, 100% coverage: 2:286/286 of query aligns to 2:306/319 of 3gayA
- binding 1,6-di-O-phosphono-D-tagatose: N23 (= N23), S49 (≠ H49), D82 (= D80), H174 (= H178), G175 (= G179), K178 (≠ P182), H206 (= H208), G207 (= G209), S209 (vs. gap), N249 (= N230), D251 (≠ S232), S252 (= S233), R255 (≠ K236)
- binding zinc ion: H83 (= H81), H174 (= H178), H206 (= H208)
3ohiA Structure of giardia fructose-1,6-biphosphate aldolase in complex with 3-hydroxy-2-pyridone (see paper)
34% identity, 100% coverage: 2:286/286 of query aligns to 2:306/319 of 3ohiA
- binding ({3-hydroxy-2-oxo-4-[2-(phosphonooxy)ethyl]pyridin-1(2H)-yl}methyl)phosphonic acid: S49 (≠ H49), D82 (= D80), H83 (= H81), H174 (= H178), G175 (= G179), K178 (≠ P182), G207 (= G209), S209 (vs. gap), N249 (= N230), D251 (≠ S232), S252 (= S233), R255 (≠ K236)
- binding zinc ion: H83 (= H81), H174 (= H178), H206 (= H208)
Query Sequence
>BWI76_RS27560 FitnessBrowser__Koxy:BWI76_RS27560
MLVSMHELLKPTREHGFAIGAFNVADSCFIRAVVEEAEATNTPAIISIHPSEHDFVGDAF
FSYVRDITQRSRVPFTLHLDHGASVEHVLRAIQCGFTSVMIDGSLLPYEENVALTREVVR
LAHAVGVSVEGELGTIGQTGTSVEGGVSEVTYTDPAQAEDFVARTGVDTLAVAIGTAHGI
YPKGMQPKLQMHILRDIAGRLSIPLVLHGGSANPDAEIAESVTLGVGKINISSDMKYAYF
QKAREILAKETWWDPNVIYPEPINAAREVIRHKMKLFGSTGKASLY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory