Comparing BWI76_RS27615 FitnessBrowser__Koxy:BWI76_RS27615 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
1shkA The three-dimensional structure of shikimate kinase from erwinia chrysanthemi (see paper)
26% identity, 68% coverage: 4:140/201 of query aligns to 5:127/158 of 1shkA
Sites not aligning to the query:
P10880 Shikimate kinase 2; SK 2; Shikimate kinase II; SKII; EC 2.7.1.71 from Dickeya chrysanthemi (Pectobacterium chrysanthemi) (Erwinia chrysanthemi) (see paper)
26% identity, 57% coverage: 4:117/201 of query aligns to 5:109/173 of P10880
Sites not aligning to the query:
2shkB The three-dimensional structure of shikimate kinase from erwinia chrysanthemi complexed with adp (see paper)
26% identity, 57% coverage: 4:117/201 of query aligns to 5:109/162 of 2shkB
Sites not aligning to the query:
>BWI76_RS27615 FitnessBrowser__Koxy:BWI76_RS27615
MNTLFLIGPGGVGKSTVGALLAQAMNYRFIDLDSEFCEQLLNIRQYIQRNGYERYVRDNA
ALCSRLLAENPHEKRVVVLSSGFLATDVCPEIVAGNRQLVRQSGYSILLLPSEDIDIATR
IVVARQLMRGFGLVREKEEMKFRQRFREYCALDDCRVVSSEEPERVAELVREKVAAEQRK
QKSLEAMRELSELSQKLGLYN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory