Comparing BWI76_RS27810 FitnessBrowser__Koxy:BWI76_RS27810 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
5yumA Crystallographic structures of ilvn.Val/ile complexes:conformational selectivity for feedback inhibition of ahass (see paper)
87% identity, 95% coverage: 6:96/96 of query aligns to 1:91/91 of 5yumA
5yppE Crystal structure of ilvn.Val-1a (see paper)
87% identity, 95% coverage: 6:96/96 of query aligns to 1:91/91 of 5yppE
A0QUX7 Acetolactate synthase small subunit; Acetohydroxy-acid synthase small subunit; AHAS; ALS; EC 2.2.1.6 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
32% identity, 88% coverage: 11:94/96 of query aligns to 10:94/170 of A0QUX7
P9WKJ3 Putative acetolactate synthase small subunit; Acetohydroxy-acid synthase small subunit; AHAS; ALS; EC 2.2.1.6 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
32% identity, 98% coverage: 1:94/96 of query aligns to 1:92/168 of P9WKJ3
2pc6A Crystal structure of putative acetolactate synthase- small subunit from nitrosomonas europaea (see paper)
33% identity, 77% coverage: 6:79/96 of query aligns to 1:75/164 of 2pc6A
Q9FFF4 Acetolactate synthase small subunit 2, chloroplastic; ALS-interacting protein 3; Acetohydroxy-acid synthase small subunit 2; Protein valine-tolerant 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 71% coverage: 11:78/96 of query aligns to 310:378/477 of Q9FFF4
Sites not aligning to the query:
6vz8G Arabidopsis thaliana acetohydroxyacid synthase complex with valine bound (see paper)
33% identity, 71% coverage: 11:78/96 of query aligns to 6:74/159 of 6vz8G
Q93YZ7 Acetolactate synthase small subunit 1, chloroplastic; ALS-interacting protein 1; Acetohydroxyacid synthase small subunit 1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
33% identity, 71% coverage: 11:78/96 of query aligns to 322:390/491 of Q93YZ7
Sites not aligning to the query:
>BWI76_RS27810 FitnessBrowser__Koxy:BWI76_RS27810
MQQATHENVILQLTVRNHPGVMTHVCGLFARRAFNVEGILCLPIQDSNQSRIWLLVNDDQ
RLGQMISQIEKLEDVEKVVRNQSDPSMFSKIAVFFE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory