SitesBLAST
Comparing BWI76_RS27815 FitnessBrowser__Koxy:BWI76_RS27815 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6lpiB Crystal structure of ahas holo-enzyme (see paper)
84% identity, 98% coverage: 8:560/562 of query aligns to 1:539/539 of 6lpiB
- active site: I27 (= I34), G29 (= G36), G30 (= G37), S31 (= S38), I32 (= I39), E53 (= E60), C76 (= C83), F115 (= F122), Q116 (= Q123), E117 (= E124), K165 (= K172), M256 (= M263), A283 (= A290), V375 (= V391), G401 (= G417), M403 (= M419), D428 (= D444), N455 (= N471), A457 (= A473), L458 (= L474), L460 (= L476), V461 (= V477), Q464 (= Q480)
- binding flavin-adenine dinucleotide: R155 (= R162), G212 (= G219), G213 (= G220), G214 (= G221), T236 (= T243), L237 (= L244), M238 (= M245), L254 (= L261), M256 (= M263), H257 (= H264), G276 (= G283), A277 (= A284), R278 (= R285), D280 (= D287), R282 (= R289), A283 (= A290), D300 (= D307), I301 (= I308), D319 (= D326), V320 (= V327), M380 (= M396), G398 (= G414)
- binding magnesium ion: D428 (= D444), N455 (= N471)
- binding thiamine diphosphate: E53 (= E60), C76 (= C83), P79 (= P86), G376 (= G392), Q377 (= Q393), H378 (= H394), G401 (= G417), M403 (= M419), G427 (= G443), D428 (= D444), G429 (= G445), S430 (= S446), M433 (= M449), N455 (= N471), A457 (= A473), L458 (= L474), G459 (= G475), L460 (= L476), V461 (= V477)
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
44% identity, 98% coverage: 15:562/562 of query aligns to 93:657/664 of P09114
- P191 (= P113) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (≠ Q480) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
44% identity, 98% coverage: 15:562/562 of query aligns to 96:660/667 of P09342
- C161 (= C80) modified: Disulfide link with 307
- P194 (= P113) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (≠ V222) modified: Disulfide link with 161
P17597 Acetolactate synthase, chloroplastic; AtALS; Acetohydroxy-acid synthase; Protein CHLORSULFURON RESISTANT 1; EC 2.2.1.6 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
43% identity, 98% coverage: 15:562/562 of query aligns to 99:663/670 of P17597
- A122 (≠ S38) mutation to V: Reduced catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- M124 (≠ L40) mutation to E: Reduced catalytic activity. Resistant to imidazolinone herbicides and reduced sensitivity to sulfonylurea herbicides.; mutation to I: No effect on catalytic activity. Increased resistance to imidazolinone herbicides.
- E144 (= E60) binding
- S186 (= S102) binding
- P197 (= P113) mutation to S: In csr1-1/GH50; resistant to sulfonylurea but not to imidazolinone herbicides.
- R199 (≠ S115) mutation R->A,E: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- Q207 (= Q123) binding
- K220 (= K136) binding
- R246 (= R162) binding ; binding
- K256 (= K172) binding
- G308 (= G220) binding
- TL 331:332 (= TL 243:244) binding
- C340 (≠ K252) modified: Cysteine sulfinic acid (-SO2H)
- LGMH 349:352 (= LGMH 261:264) binding
- GVRFD 371:375 (≠ GARFD 283:287) binding
- DR 376:377 (= DR 288:289) binding
- DI 395:396 (= DI 307:308) binding
- DV 414:415 (= DV 326:327) binding
- QH 487:488 (= QH 393:394) binding
- GG 508:509 (= GG 414:415) binding
- GAM 511:513 (≠ GTM 417:419) binding
- D538 (= D444) binding
- DGS 538:540 (= DGS 444:446) binding
- N565 (= N471) binding
- NQHLGM 565:570 (≠ NEALGL 471:476) binding
- H567 (≠ A473) binding
- W574 (≠ Q480) binding ; mutation to L: Increased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.; mutation to S: Slightly decreased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.
- S653 (≠ P552) binding ; mutation to A: No effect on catalytic activity or sensitivity to herbicides.; mutation to F: No effect on catalytic activity. Resistant to imidazolinone herbicides and also slightly sulfonylurea-resistant.; mutation to N: In csr1-2/GH90; no effect on catalytic activity. Resistant to imidazolinone but not to sulfonylurea herbicides.; mutation to T: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
43% identity, 98% coverage: 15:562/562 of query aligns to 14:578/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V391), G401 (= G392), Q402 (= Q393), H403 (= H394), G426 (= G417), M428 (= M419), G452 (= G443), D453 (= D444), G454 (= G445), S455 (= S446), M458 (= M449), N480 (= N471), H482 (≠ A473), L483 (= L474), G484 (= G475), M485 (≠ L476), V486 (= V477)
- binding flavin-adenine dinucleotide: R161 (= R162), G222 (= G219), G223 (= G220), G224 (= G221), T246 (= T243), L247 (= L244), M248 (= M245), L264 (= L261), M266 (= M263), H267 (= H264), G286 (= G283), V287 (≠ A284), R288 (= R285), D290 (= D287), R292 (= R289), V293 (≠ A290), D310 (= D307), I311 (= I308), D329 (= D326), V330 (= V327), M405 (= M396), G423 (= G414)
- binding magnesium ion: F370 (≠ I361), D453 (= D444), M458 (= M449), Q461 (= Q452), N480 (= N471), H482 (≠ A473), K533 (≠ E517)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (= M263), R292 (= R289), M485 (≠ L476), W489 (≠ Q480), S568 (≠ P552)
5wj1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a triazolopyrimidine herbicide, penoxsulam (see paper)
43% identity, 98% coverage: 15:562/562 of query aligns to 14:578/582 of 5wj1A
- active site: Y33 (≠ I34), G35 (= G36), G36 (= G37), A37 (≠ S38), S38 (≠ I39), E59 (= E60), T82 (≠ C83), F121 (= F122), Q122 (= Q123), E123 (= E124), K171 (= K172), M266 (= M263), V293 (≠ A290), V400 (= V391), G426 (= G417), M428 (= M419), D453 (= D444), N480 (= N471), H482 (≠ A473), L483 (= L474), M485 (≠ L476), V486 (= V477), W489 (≠ Q480), H558 (≠ A542)
- binding flavin-adenine dinucleotide: R161 (= R162), G222 (= G219), G223 (= G220), G224 (= G221), T246 (= T243), L247 (= L244), M248 (= M245), M263 (= M260), L264 (= L261), G286 (= G283), R288 (= R285), V293 (≠ A290), D310 (= D307), I311 (= I308), D329 (= D326), V330 (= V327), M405 (= M396), G423 (= G414), G424 (= G415)
- binding magnesium ion: D453 (= D444), N480 (= N471), H482 (≠ A473)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M266 (= M263), D291 (= D288), R292 (= R289), M485 (≠ L476), W489 (≠ Q480), S568 (≠ P552)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V391), G401 (= G392), Q402 (= Q393), H403 (= H394), M428 (= M419), D453 (= D444), G454 (= G445), S455 (= S446), M458 (= M449), N480 (= N471), H482 (≠ A473), L483 (= L474), G484 (= G475), M485 (≠ L476), V486 (= V477)
5k6tA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, propoxycarbazone-sodium (see paper)
43% identity, 98% coverage: 15:562/562 of query aligns to 14:578/582 of 5k6tA
- active site: Y33 (≠ I34), G35 (= G36), G36 (= G37), A37 (≠ S38), S38 (≠ I39), E59 (= E60), T82 (≠ C83), F121 (= F122), Q122 (= Q123), E123 (= E124), K171 (= K172), M266 (= M263), V293 (≠ A290), V400 (= V391), G426 (= G417), M428 (= M419), D453 (= D444), N480 (= N471), H482 (≠ A473), L483 (= L474), M485 (≠ L476), V486 (= V477), W489 (≠ Q480), H558 (≠ A542)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: H267 (= H264), R292 (= R289), M485 (≠ L476), W489 (≠ Q480), S568 (≠ P552)
- binding flavin-adenine dinucleotide: R161 (= R162), G222 (= G219), G223 (= G220), G224 (= G221), T246 (= T243), L247 (= L244), M248 (= M245), L264 (= L261), G286 (= G283), R288 (= R285), D290 (= D287), R292 (= R289), V293 (≠ A290), D310 (= D307), I311 (= I308), D329 (= D326), V330 (= V327), Q404 (= Q395), M405 (= M396), G423 (= G414)
- binding magnesium ion: D453 (= D444), N480 (= N471), H482 (≠ A473)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V391), G401 (= G392), Q402 (= Q393), H403 (= H394), G426 (= G417), M428 (= M419), G452 (= G443), G454 (= G445), S455 (= S446), N480 (= N471), H482 (≠ A473), L483 (= L474), G484 (= G475)
5k6rA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, thiencarbazone-methyl (see paper)
43% identity, 98% coverage: 15:562/562 of query aligns to 14:578/582 of 5k6rA
- active site: Y33 (≠ I34), G35 (= G36), G36 (= G37), A37 (≠ S38), S38 (≠ I39), E59 (= E60), T82 (≠ C83), F121 (= F122), Q122 (= Q123), E123 (= E124), K171 (= K172), M266 (= M263), V293 (≠ A290), V400 (= V391), G426 (= G417), M428 (= M419), D453 (= D444), N480 (= N471), H482 (≠ A473), L483 (= L474), M485 (≠ L476), V486 (= V477), W489 (≠ Q480), H558 (≠ A542)
- binding methyl 4-[(3-methoxy-4-methyl-5-oxidanylidene-1,2,4-triazol-1-yl)carbonylsulfamoyl]-5-methyl-thiophene-3-carboxylate: R292 (= R289), W489 (≠ Q480), S568 (≠ P552)
- binding flavin-adenine dinucleotide: R161 (= R162), G222 (= G219), G223 (= G220), G224 (= G221), T246 (= T243), L247 (= L244), M248 (= M245), L264 (= L261), M266 (= M263), G286 (= G283), R288 (= R285), R292 (= R289), V293 (≠ A290), D310 (= D307), I311 (= I308), G328 (= G325), D329 (= D326), V330 (= V327), M405 (= M396), G423 (= G414)
- binding magnesium ion: D453 (= D444), N480 (= N471), H482 (≠ A473)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V391), G401 (= G392), Q402 (= Q393), H403 (= H394), G426 (= G417), M428 (= M419), D453 (= D444), G454 (= G445), S455 (= S446), M458 (= M449), N480 (= N471), H482 (≠ A473), L483 (= L474), G484 (= G475), M485 (≠ L476), V486 (= V477)
1z8nA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with an imidazolinone herbicide, imazaquin (see paper)
43% identity, 98% coverage: 15:562/562 of query aligns to 14:578/582 of 1z8nA
- active site: Y33 (≠ I34), G35 (= G36), G36 (= G37), A37 (≠ S38), S38 (≠ I39), E59 (= E60), T82 (≠ C83), F121 (= F122), Q122 (= Q123), E123 (= E124), K171 (= K172), M266 (= M263), V293 (≠ A290), V400 (= V391), G426 (= G417), M428 (= M419), D453 (= D444), N480 (= N471), H482 (≠ A473), L483 (= L474), M485 (≠ L476), V486 (= V477), W489 (≠ Q480), H558 (≠ A542)
- binding 2-(4-isopropyl-4-methyl-5-oxo-4,5-dihydro-1h-imidazol-2-yl)quinoline-3-carboxylic acid: K135 (= K136), R161 (= R162), Y191 (vs. gap), R194 (= R190), D291 (= D288), R292 (= R289), D312 (= D309), W489 (≠ Q480), G569 (= G553)
- binding flavin-adenine dinucleotide: R161 (= R162), G222 (= G219), G224 (= G221), T246 (= T243), L247 (= L244), M248 (= M245), L264 (= L261), G265 (= G262), M266 (= M263), H267 (= H264), G286 (= G283), V287 (≠ A284), R288 (= R285), D290 (= D287), R292 (= R289), V293 (≠ A290), D310 (= D307), I311 (= I308), D329 (= D326), V330 (= V327), M405 (= M396), G423 (= G414), G424 (= G415)
- binding magnesium ion: D453 (= D444), N480 (= N471)
- binding thiamine diphosphate: V400 (= V391), G401 (= G392), Q402 (= Q393), H403 (= H394), G426 (= G417), M428 (= M419), G452 (= G443), G454 (= G445), S455 (= S446), N480 (= N471), H482 (≠ A473), L483 (= L474), G484 (= G475), M485 (≠ L476), V486 (= V477)
1yi1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
43% identity, 98% coverage: 15:562/562 of query aligns to 14:578/582 of 1yi1A
- active site: Y33 (≠ I34), G35 (= G36), G36 (= G37), A37 (≠ S38), S38 (≠ I39), E59 (= E60), T82 (≠ C83), F121 (= F122), Q122 (= Q123), E123 (= E124), K171 (= K172), M266 (= M263), V293 (≠ A290), V400 (= V391), G426 (= G417), M428 (= M419), D453 (= D444), N480 (= N471), H482 (≠ A473), L483 (= L474), M485 (≠ L476), V486 (= V477), W489 (≠ Q480), H558 (≠ A542)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: D291 (= D288), R292 (= R289), W489 (≠ Q480), S568 (≠ P552)
- binding flavin-adenine dinucleotide: R161 (= R162), G223 (= G220), G224 (= G221), T246 (= T243), L247 (= L244), M248 (= M245), M263 (= M260), L264 (= L261), G265 (= G262), M266 (= M263), H267 (= H264), G286 (= G283), V287 (≠ A284), R288 (= R285), D290 (= D287), V293 (≠ A290), D310 (= D307), I311 (= I308), D329 (= D326), V330 (= V327), M405 (= M396), G423 (= G414), G424 (= G415)
- binding magnesium ion: D453 (= D444), N480 (= N471), H482 (≠ A473)
1yi0A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
43% identity, 98% coverage: 15:562/562 of query aligns to 14:578/582 of 1yi0A
- active site: Y33 (≠ I34), G35 (= G36), G36 (= G37), A37 (≠ S38), S38 (≠ I39), E59 (= E60), T82 (≠ C83), F121 (= F122), Q122 (= Q123), E123 (= E124), K171 (= K172), M266 (= M263), V293 (≠ A290), V400 (= V391), G426 (= G417), M428 (= M419), D453 (= D444), N480 (= N471), H482 (≠ A473), L483 (= L474), M485 (≠ L476), V486 (= V477), W489 (≠ Q480), H558 (≠ A542)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D288), R292 (= R289), W489 (≠ Q480), S568 (≠ P552)
- binding flavin-adenine dinucleotide: R161 (= R162), G222 (= G219), G223 (= G220), G224 (= G221), T246 (= T243), L247 (= L244), M248 (= M245), L264 (= L261), G265 (= G262), M266 (= M263), H267 (= H264), G286 (= G283), V287 (≠ A284), R288 (= R285), D290 (= D287), R292 (= R289), V293 (≠ A290), D310 (= D307), I311 (= I308), G328 (= G325), D329 (= D326), V330 (= V327), M405 (= M396), G423 (= G414), G424 (= G415)
- binding magnesium ion: D453 (= D444), N480 (= N471), H482 (≠ A473)
1yhzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
43% identity, 98% coverage: 15:562/562 of query aligns to 14:578/582 of 1yhzA
- active site: Y33 (≠ I34), G35 (= G36), G36 (= G37), A37 (≠ S38), S38 (≠ I39), E59 (= E60), T82 (≠ C83), F121 (= F122), Q122 (= Q123), E123 (= E124), K171 (= K172), M266 (= M263), V293 (≠ A290), V400 (= V391), G426 (= G417), M428 (= M419), D453 (= D444), N480 (= N471), H482 (≠ A473), L483 (= L474), M485 (≠ L476), V486 (= V477), W489 (≠ Q480), H558 (≠ A542)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: D291 (= D288), R292 (= R289), M485 (≠ L476), W489 (≠ Q480), S568 (≠ P552)
- binding flavin-adenine dinucleotide: R161 (= R162), G223 (= G220), G224 (= G221), T246 (= T243), L247 (= L244), M248 (= M245), L264 (= L261), M266 (= M263), H267 (= H264), G286 (= G283), V287 (≠ A284), R288 (= R285), D290 (= D287), V293 (≠ A290), D310 (= D307), I311 (= I308), D329 (= D326), V330 (= V327), Q404 (= Q395), M405 (= M396), G423 (= G414), G424 (= G415)
- binding magnesium ion: D453 (= D444), N480 (= N471), H482 (≠ A473)
1yhyA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
43% identity, 98% coverage: 15:562/562 of query aligns to 14:578/582 of 1yhyA
- active site: Y33 (≠ I34), G35 (= G36), G36 (= G37), A37 (≠ S38), S38 (≠ I39), E59 (= E60), T82 (≠ C83), F121 (= F122), Q122 (= Q123), E123 (= E124), K171 (= K172), M266 (= M263), V293 (≠ A290), V400 (= V391), G426 (= G417), M428 (= M419), D453 (= D444), N480 (= N471), H482 (≠ A473), L483 (= L474), M485 (≠ L476), V486 (= V477), W489 (≠ Q480), H558 (≠ A542)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D288), R292 (= R289), V486 (= V477), W489 (≠ Q480), S568 (≠ P552)
- binding flavin-adenine dinucleotide: R161 (= R162), G222 (= G219), G223 (= G220), G224 (= G221), T246 (= T243), L247 (= L244), M248 (= M245), L264 (= L261), G265 (= G262), M266 (= M263), H267 (= H264), G286 (= G283), V287 (≠ A284), R288 (= R285), D290 (= D287), V293 (≠ A290), D310 (= D307), I311 (= I308), D329 (= D326), V330 (= V327), Q404 (= Q395), M405 (= M396), G423 (= G414), G424 (= G415)
- binding magnesium ion: D453 (= D444), N480 (= N471), H482 (≠ A473)
1ybhA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide chlorimuron ethyl (see paper)
43% identity, 98% coverage: 15:562/562 of query aligns to 14:578/582 of 1ybhA
- active site: Y33 (≠ I34), G35 (= G36), G36 (= G37), A37 (≠ S38), S38 (≠ I39), E59 (= E60), T82 (≠ C83), F121 (= F122), Q122 (= Q123), E123 (= E124), K171 (= K172), M266 (= M263), V293 (≠ A290), V400 (= V391), G426 (= G417), M428 (= M419), D453 (= D444), N480 (= N471), H482 (≠ A473), L483 (= L474), M485 (≠ L476), V486 (= V477), W489 (≠ Q480), H558 (≠ A542)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: M266 (= M263), D291 (= D288), R292 (= R289), M485 (≠ L476), W489 (≠ Q480), S568 (≠ P552)
- binding flavin-adenine dinucleotide: R161 (= R162), G223 (= G220), G224 (= G221), T246 (= T243), L247 (= L244), M248 (= M245), L264 (= L261), M266 (= M263), H267 (= H264), G286 (= G283), V287 (≠ A284), R288 (= R285), D290 (= D287), V293 (≠ A290), D310 (= D307), I311 (= I308), D329 (= D326), V330 (= V327), Q404 (= Q395), M405 (= M396), G423 (= G414), G424 (= G415)
- binding magnesium ion: D453 (= D444), N480 (= N471), H482 (≠ A473)
3ea4A Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron-ester (see paper)
43% identity, 98% coverage: 15:562/562 of query aligns to 13:577/582 of 3ea4A
- active site: Y32 (≠ I34), G34 (= G36), G35 (= G37), A36 (≠ S38), S37 (≠ I39), E58 (= E60), T81 (≠ C83), F120 (= F122), Q121 (= Q123), E122 (= E124), K170 (= K172), M265 (= M263), V292 (≠ A290), V399 (= V391), G425 (= G417), M427 (= M419), D452 (= D444), N479 (= N471), H481 (≠ A473), L482 (= L474), M484 (≠ L476), V485 (= V477), W488 (≠ Q480), H557 (≠ A542)
- binding methyl 2-{[(4-methylpyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: D290 (= D288), R291 (= R289), W488 (≠ Q480), S567 (≠ P552)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R162), G221 (= G219), G222 (= G220), G223 (= G221), T245 (= T243), L246 (= L244), M247 (= M245), L263 (= L261), G264 (= G262), M265 (= M263), H266 (= H264), G285 (= G283), R287 (= R285), D289 (= D287), R291 (= R289), D309 (= D307), I310 (= I308), G327 (= G325), D328 (= D326), V329 (= V327), M404 (= M396), G422 (= G414)
- binding magnesium ion: D452 (= D444), N479 (= N471), H481 (≠ A473)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V391), G400 (= G392), Q401 (= Q393), H402 (= H394), M427 (= M419), G451 (= G443), D452 (= D444), G453 (= G445), S454 (= S446), N479 (= N471), H481 (≠ A473), L482 (= L474), G483 (= G475), M484 (≠ L476), V485 (= V477)
3e9yA Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron (see paper)
43% identity, 98% coverage: 15:562/562 of query aligns to 13:577/582 of 3e9yA
- active site: Y32 (≠ I34), G34 (= G36), G35 (= G37), A36 (≠ S38), S37 (≠ I39), E58 (= E60), T81 (≠ C83), F120 (= F122), Q121 (= Q123), E122 (= E124), K170 (= K172), M265 (= M263), V292 (≠ A290), V399 (= V391), G425 (= G417), M427 (= M419), D452 (= D444), N479 (= N471), H481 (≠ A473), L482 (= L474), M484 (≠ L476), V485 (= V477), W488 (≠ Q480), H557 (≠ A542)
- binding N-[(4-methylpyrimidin-2-yl)carbamoyl]-2-nitrobenzenesulfonamide: D290 (= D288), R291 (= R289), W488 (≠ Q480), S567 (≠ P552)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R162), G221 (= G219), G222 (= G220), G223 (= G221), T245 (= T243), L246 (= L244), M247 (= M245), L263 (= L261), G285 (= G283), R287 (= R285), D289 (= D287), R291 (= R289), D309 (= D307), I310 (= I308), G327 (= G325), D328 (= D326), V329 (= V327), M404 (= M396), G422 (= G414)
- binding magnesium ion: D452 (= D444), N479 (= N471), H481 (≠ A473)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V391), G400 (= G392), Q401 (= Q393), H402 (= H394), M427 (= M419), G451 (= G443), G453 (= G445), S454 (= S446), N479 (= N471), H481 (≠ A473), L482 (= L474), G483 (= G475), M484 (≠ L476), V485 (= V477)
5k2oA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac (see paper)
43% identity, 98% coverage: 15:562/562 of query aligns to 14:578/585 of 5k2oA
- active site: Y33 (≠ I34), G35 (= G36), G36 (= G37), A37 (≠ S38), S38 (≠ I39), E59 (= E60), T82 (≠ C83), F121 (= F122), Q122 (= Q123), E123 (= E124), K171 (= K172), M266 (= M263), V293 (≠ A290), V400 (= V391), G426 (= G417), M428 (= M419), D453 (= D444), N480 (= N471), H482 (≠ A473), L483 (= L474), M485 (≠ L476), V486 (= V477), W489 (≠ Q480), H558 (≠ A542)
- binding 2-chloranyl-6-(4,6-dimethoxypyrimidin-2-yl)sulfanyl-benzoic acid: M266 (= M263), R292 (= R289), W489 (≠ Q480), S568 (≠ P552)
- binding flavin-adenine dinucleotide: R161 (= R162), G222 (= G219), G223 (= G220), G224 (= G221), T246 (= T243), L247 (= L244), M248 (= M245), L264 (= L261), G286 (= G283), R288 (= R285), D290 (= D287), V293 (≠ A290), D310 (= D307), I311 (= I308), D329 (= D326), V330 (= V327), Q404 (= Q395), M405 (= M396), G423 (= G414)
- binding magnesium ion: D453 (= D444), N480 (= N471), H482 (≠ A473)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V391), G401 (= G392), Q402 (= Q393), H403 (= H394), M428 (= M419), D453 (= D444), G454 (= G445), S455 (= S446), N480 (= N471), H482 (≠ A473), L483 (= L474), G484 (= G475), M485 (≠ L476), V486 (= V477)
5k3sA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, bispyribac-sodium (see paper)
43% identity, 98% coverage: 15:562/562 of query aligns to 14:578/583 of 5k3sA
- active site: Y33 (≠ I34), G35 (= G36), G36 (= G37), A37 (≠ S38), S38 (≠ I39), E59 (= E60), T82 (≠ C83), F121 (= F122), Q122 (= Q123), E123 (= E124), K171 (= K172), M266 (= M263), V293 (≠ A290), V400 (= V391), G426 (= G417), M428 (= M419), D453 (= D444), N480 (= N471), H482 (≠ A473), L483 (= L474), M485 (≠ L476), V486 (= V477), W489 (≠ Q480), H558 (≠ A542)
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: R292 (= R289), M485 (≠ L476), W489 (≠ Q480), G569 (= G553)
- binding flavin-adenine dinucleotide: R161 (= R162), G222 (= G219), G223 (= G220), G224 (= G221), T246 (= T243), L247 (= L244), M248 (= M245), L264 (= L261), M266 (= M263), G286 (= G283), R288 (= R285), D290 (= D287), V293 (≠ A290), D310 (= D307), I311 (= I308), D329 (= D326), V330 (= V327), M405 (= M396), G423 (= G414)
- binding magnesium ion: D453 (= D444), N480 (= N471), H482 (≠ A473)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V391), G401 (= G392), Q402 (= Q393), H403 (= H394), G426 (= G417), M428 (= M419), D453 (= D444), G454 (= G445), S455 (= S446), N480 (= N471), H482 (≠ A473), L483 (= L474), G484 (= G475), M485 (≠ L476), V486 (= V477)
7tzzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase p197t mutant in complex with bispyribac-sodium (see paper)
43% identity, 98% coverage: 15:562/562 of query aligns to 14:578/582 of 7tzzA
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: M266 (= M263), R292 (= R289), W489 (≠ Q480), S568 (≠ P552)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V391), G401 (= G392), Q402 (= Q393), H403 (= H394), G426 (= G417), M428 (= M419), G452 (= G443), D453 (= D444), G454 (= G445), S455 (= S446), L483 (= L474), G484 (= G475), M485 (≠ L476), V486 (= V477)
- binding flavin-adenine dinucleotide: R161 (= R162), G222 (= G219), G223 (= G220), G224 (= G221), T246 (= T243), L247 (= L244), M248 (= M245), M263 (= M260), L264 (= L261), M266 (= M263), H267 (= H264), G286 (= G283), R288 (= R285), V293 (≠ A290), D310 (= D307), I311 (= I308), D329 (= D326), V330 (= V327), M405 (= M396), G423 (= G414)
- binding magnesium ion: A37 (≠ S38), T82 (≠ C83), S83 (= S84), Q122 (= Q123), Y381 (≠ G372), D453 (= D444), M458 (= M449), Q461 (= Q452), N480 (= N471), H482 (≠ A473), K533 (≠ E517)
6denA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide iodomuron ethyl (see paper)
41% identity, 98% coverage: 13:560/562 of query aligns to 14:577/599 of 6denA
- active site: Y35 (≠ I34), G37 (= G36), G38 (= G37), A39 (≠ S38), I40 (= I39), E61 (= E60), T84 (≠ C83), F123 (= F122), Q124 (= Q123), E125 (= E124), K173 (= K172), K230 (≠ E227), M266 (= M263), V293 (≠ A290), V409 (= V391), L434 (= L416), G435 (= G417), M437 (= M419), D462 (= D444), N489 (= N471), E491 (≠ A473), Q492 (≠ L474), M494 (≠ L476), V495 (= V477), W498 (≠ Q480), L520 (≠ I503), N525 (≠ G508), V526 (≠ L509)
- binding flavin-adenine dinucleotide: R163 (= R162), G219 (= G219), A220 (≠ G220), G221 (= G221), N224 (= N224), T246 (= T243), L247 (= L244), Q248 (≠ M245), L264 (= L261), G286 (= G283), A287 (= A284), R288 (= R285), D290 (= D287), R292 (= R289), V293 (≠ A290), E319 (≠ D307), I320 (= I308), N324 (≠ E312), D338 (= D326), V339 (= V327), M414 (= M396), G432 (= G414)
- binding ethyl 2-{[(4-iodo-6-methoxypyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: M266 (= M263), D291 (= D288), R292 (= R289), W498 (≠ Q480)
- binding magnesium ion: D462 (= D444), N489 (= N471), E491 (≠ A473)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V409 (= V391), G410 (= G392), Q411 (= Q393), H412 (= H394), G435 (= G417), M437 (= M419), G461 (= G443), D462 (= D444), A463 (≠ G445), S464 (= S446), N489 (= N471), E491 (≠ A473), Q492 (≠ L474), G493 (= G475), M494 (≠ L476), V495 (= V477)
Query Sequence
>BWI76_RS27815 FitnessBrowser__Koxy:BWI76_RS27815
MASSGTTSEKMRFTGAQLVVHLLERQGITTVSGIPGGSILPIYDALSQSTQIRHILARHE
QGAGFIAQGMARTEGKPAVCMACSGPGATNLITAIADARLDSIPLVCITGQVPASMIGTD
AFQEVDTYGISIPITKHNYLVRNIAELPQVMSDAFRIAQSGRPGPVWIDIPKDVQAATIE
LDALPEPGARMAAPEFDSASVREAAAMINAAQRPVLYLGGGVINAPEHIRQLAEKANLPT
TQTLMALGMLPKAHPLSLGMLGMHGARSTNFILQEADLLVVLGARFDDRAIGKTEQFCPN
AKIIHVDIDRSELGKIKQAHVAIQGDVGEVLEQLIPQVEAQPRSAWLQLVADLQREFPCT
IPQEQDPLSHYGLINAVAACVDDEAIVTTDVGQHQMWVAQAYPLNRPRQWLTSGGLGTMG
FGLPAAVGAALANPQRKVICFSGDGSLMMNIQEMATAAENQLDVKIILMNNEALGLVYQQ
QSLFYKQGVFAATYPGMVNFMQIASGFGLQTCDLNNEADPQAALQAIIDRPGPALIHVRI
DAEEKVYPMVPPGAANTEMVGE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory