Comparing BWI76_RS27880 FitnessBrowser__Koxy:BWI76_RS27880 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
6dvvA 2.25 angstrom resolution crystal structure of 6-phospho-alpha- glucosidase from klebsiella pneumoniae in complex with NAD and mn2+. (see paper)
97% identity, 100% coverage: 1:440/440 of query aligns to 1:435/435 of 6dvvA
Q97LM4 Maltose-6'-phosphate glucosidase MalH; 6-phospho-alpha-glucosidase; 6-phospho-glucosidase; Maltose-6-phosphate hydrolase; EC 3.2.1.122 from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) (see paper)
76% identity, 100% coverage: 1:440/440 of query aligns to 1:441/441 of Q97LM4
P54716 Maltose-6'-phosphate glucosidase; 6-phospho-alpha-D-glucosidase; 6-phosphoryl-O-alpha-D-glucopyranosyl:phosphoglucohydrolase; EC 3.2.1.122 from Bacillus subtilis (strain 168) (see paper)
72% identity, 100% coverage: 2:439/440 of query aligns to 4:441/449 of P54716
1u8xX Crystal structure of glva from bacillus subtilis, a metal-requiring, NAD-dependent 6-phospho-alpha-glucosidase (see paper)
71% identity, 100% coverage: 2:439/440 of query aligns to 2:432/436 of 1u8xX
6vc6B 2.1 angstrom resolution crystal structure of 6-phospho-alpha- glucosidase from gut microorganisms in complex with NAD and mn2+
45% identity, 100% coverage: 2:439/440 of query aligns to 1:439/440 of 6vc6B
6wbtA 2.52 angstrom resolution crystal structure of 6-phospho-alpha- glucosidase from gut microorganisms in complex with NAD and glucose- 6-phosphate
46% identity, 100% coverage: 2:439/440 of query aligns to 2:441/442 of 6wbtA
5c3mB Crystal structure of gan4c, a gh4 6-phospho-glucosidase from geobacillus stearothermophilus
29% identity, 98% coverage: 10:439/440 of query aligns to 7:410/411 of 5c3mB
1up7A Structure of the 6-phospho-beta glucosidase from thermotoga maritima at 2.4 angstrom resolution in the tetragonal form with NAD and glucose-6-phosphate (see paper)
28% identity, 98% coverage: 6:435/440 of query aligns to 5:410/414 of 1up7A
1up6A Structure of the 6-phospho-beta glucosidase from thermotoga maritima at 2.55 angstrom resolution in the tetragonal form with manganese, NAD+ and glucose-6-phosphate (see paper)
28% identity, 98% coverage: 6:435/440 of query aligns to 4:409/413 of 1up6A
P39130 Alpha-galacturonidase; EC 3.2.1.67 from Bacillus subtilis (strain 168) (see paper)
24% identity, 74% coverage: 72:396/440 of query aligns to 74:406/446 of P39130
3fefA Crystal structure of putative glucosidase lpld from bacillus subtilis
24% identity, 74% coverage: 72:396/440 of query aligns to 68:400/434 of 3fefA
Q9AI65 Alpha-glucosidase; EC 3.2.1.20 from Erwinia rhapontici (Pectobacterium rhapontici) (see paper)
24% identity, 98% coverage: 6:436/440 of query aligns to 6:448/453 of Q9AI65
Sites not aligning to the query:
3u95A Crystal structure of a putative alpha-glucosidase from thermotoga neapolitana (see paper)
24% identity, 61% coverage: 97:366/440 of query aligns to 107:390/468 of 3u95A
O33830 Alpha-glucosidase; Maltase; EC 3.2.1.20 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
23% identity, 56% coverage: 1:248/440 of query aligns to 1:245/480 of O33830
1obbA Alpha-glucosidase a, agla, from thermotoga maritima in complex with maltose and NAD+ (see paper)
23% identity, 55% coverage: 7:248/440 of query aligns to 7:244/478 of 1obbA
Sites not aligning to the query:
>BWI76_RS27880 FitnessBrowser__Koxy:BWI76_RS27880
MKKFSVVIAGGGSTFTPGIVLMLLANQDRFPLRALKFYDNDGARQETIAEACKVILKEQA
PEIAFSYTTDPQAAFTDVDFVMAHIRVGKYPMREKDEKIPLRHGVLGQETCGPGGIAYGM
RSIGGVLELVDYMEKYSPNAWMLNYSNPAAIVAEATRRLRPNAKILNICDMPIGIEGRMA
QIVGLKDRKQMRVRYYGLNHFGWWTSIEDLQGNDLMPKLREYVAKYGYVPPSNDPHTEAS
WNDTFAKAKDVQALDPDTMPNTYLKYYLFPDYVVAHSNPERTRANEVMDHREKNVFSACR
AIIAAGKSSAGDLEIDEHASYIVDLAAAIAFNTQERMLLIVPNNGAIHNFDADAMVEIPC
LVGHNGPEPLTVGDIPHFQKGMMSQQVAVEKLVVDAWEQRSYHKLWQAIALSKTVPSASV
AKAILDDLIAANKAYWPELH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory