SitesBLAST
Comparing BWI76_RS27925 FitnessBrowser__Koxy:BWI76_RS27925 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q65CJ7 Hydroxyphenylpyruvate reductase; HPPR; EC 1.1.1.237 from Plectranthus scutellarioides (Coleus) (Solenostemon scutellarioides) (see paper)
42% identity, 97% coverage: 5:309/314 of query aligns to 6:312/313 of Q65CJ7
3bazA Structure of hydroxyphenylpyruvate reductase from coleus blumei in complex with NADP+ (see paper)
42% identity, 97% coverage: 5:309/314 of query aligns to 4:310/311 of 3bazA
- active site: L98 (= L97), R230 (= R229), A251 (= A250), D254 (= D253), E259 (= E258), H277 (= H276)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V74 (= V73), G149 (= G148), L150 (≠ M149), G151 (= G150), R152 (= R151), I153 (= I152), S172 (≠ D171), R173 (= R172), S174 (≠ K173), C201 (≠ T200), P202 (= P201), T207 (≠ N206), I228 (= I227), G229 (≠ S228), R230 (= R229), D254 (= D253), H277 (= H276), G279 (≠ A278)
5j23A Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with 2'-phospho-adp-ribose (see paper)
44% identity, 93% coverage: 19:309/314 of query aligns to 15:308/318 of 5j23A
- active site: L94 (= L97), R228 (= R229), D252 (= D253), E257 (= E258), H275 (= H276)
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4r,5r)-3,4,5-trihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: V70 (= V73), L148 (≠ M149), G149 (= G150), R150 (= R151), I151 (= I152), T170 (≠ D171), R171 (= R172), P200 (= P201), S204 (≠ E205), T205 (≠ N206), R228 (= R229)
5v6qB Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and malonate (see paper)
44% identity, 93% coverage: 19:309/314 of query aligns to 17:310/319 of 5v6qB
- active site: L96 (= L97), R230 (= R229), D254 (= D253), E259 (= E258), H277 (= H276)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V72 (= V73), V100 (= V101), F148 (≠ V147), L150 (≠ M149), G151 (= G150), R152 (= R151), I153 (= I152), T172 (≠ D171), R173 (= R172), V201 (≠ T200), P202 (= P201), S206 (≠ E205), T207 (≠ N206), V228 (≠ I227), G229 (≠ S228), R230 (= R229), H277 (= H276), A279 (= A278)
5v7nA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and 2-keto-d-gluconic acid (see paper)
44% identity, 93% coverage: 19:309/314 of query aligns to 16:309/319 of 5v7nA
- active site: L95 (= L97), R229 (= R229), D253 (= D253), E258 (= E258), H276 (= H276)
- binding 2-keto-D-gluconic acid: G70 (= G72), V71 (= V73), G72 (= G74), R229 (= R229), H276 (= H276), S279 (= S279), R285 (= R285)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V71 (= V73), V99 (= V101), L149 (≠ M149), G150 (= G150), R151 (= R151), I152 (= I152), T171 (≠ D171), R172 (= R172), V200 (≠ T200), P201 (= P201), S205 (≠ E205), T206 (≠ N206), V227 (≠ I227), G228 (≠ S228), R229 (= R229), H276 (= H276), A278 (= A278)
5v7gA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADPH and oxalate (see paper)
44% identity, 93% coverage: 19:309/314 of query aligns to 15:308/317 of 5v7gA
- active site: L94 (= L97), R228 (= R229), D252 (= D253), E257 (= E258), H275 (= H276)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V70 (= V73), V98 (= V101), F146 (≠ V147), L148 (≠ M149), G149 (= G150), R150 (= R151), I151 (= I152), T170 (≠ D171), R171 (= R172), V199 (≠ T200), P200 (= P201), S204 (≠ E205), T205 (≠ N206), V226 (≠ I227), G227 (≠ S228), R228 (= R229), H275 (= H276), A277 (= A278)
- binding oxalate ion: G69 (= G72), V70 (= V73), G71 (= G74), R228 (= R229), H275 (= H276)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
39% identity, 86% coverage: 31:301/314 of query aligns to 34:313/334 of 5aovA
- active site: L100 (= L97), R241 (= R229), D265 (= D253), E270 (= E258), H288 (= H276)
- binding glyoxylic acid: M52 (≠ N49), L53 (≠ G50), L53 (≠ G50), Y74 (≠ F71), A75 (≠ G72), V76 (= V73), G77 (= G74), R241 (= R229), H288 (= H276)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (= V73), T104 (≠ V101), F158 (≠ M149), G159 (= G150), R160 (= R151), I161 (= I152), S180 (≠ D171), R181 (= R172), A211 (≠ C199), V212 (≠ T200), P213 (= P201), T218 (≠ N206), I239 (= I227), A240 (≠ S228), R241 (= R229), H288 (= H276), G290 (≠ A278)
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
39% identity, 85% coverage: 31:296/314 of query aligns to 33:307/332 of 6biiA
- active site: L99 (= L97), R240 (= R229), D264 (= D253), E269 (= E258), H287 (= H276)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (= V73), T103 (≠ V101), G156 (= G148), F157 (≠ M149), G158 (= G150), R159 (= R151), I160 (= I152), A179 (≠ D171), R180 (= R172), S181 (≠ K173), K183 (≠ I175), V211 (≠ T200), P212 (= P201), E216 (= E205), T217 (≠ N206), V238 (≠ I227), A239 (≠ S228), R240 (= R229), D264 (= D253), H287 (= H276), G289 (≠ A278)
O58320 Glyoxylate reductase; EC 1.1.1.26 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
37% identity, 96% coverage: 1:301/314 of query aligns to 1:313/334 of O58320
2dbqA Crystal structure of glyoxylate reductase (ph0597) from pyrococcus horikoshii ot3, complexed with NADP (i41) (see paper)
37% identity, 96% coverage: 1:301/314 of query aligns to 1:313/333 of 2dbqA
- active site: L100 (= L97), R241 (= R229), D265 (= D253), E270 (= E258), H288 (= H276)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (= V73), T104 (≠ V101), L158 (≠ M149), G159 (= G150), R160 (= R151), I161 (= I152), S180 (≠ D171), R181 (= R172), T182 (≠ K173), A211 (≠ C199), V212 (≠ T200), P213 (= P201), T218 (≠ N206), I239 (= I227), A240 (≠ S228), R241 (= R229), D265 (= D253), H288 (= H276), G290 (≠ A278)
Q9UBQ7 Glyoxylate reductase/hydroxypyruvate reductase; EC 1.1.1.79; EC 1.1.1.81 from Homo sapiens (Human) (see paper)
38% identity, 74% coverage: 64:296/314 of query aligns to 74:313/328 of Q9UBQ7
2gcgA Ternary crystal structure of human glyoxylate reductase/hydroxypyruvate reductase (see paper)
38% identity, 74% coverage: 64:296/314 of query aligns to 70:309/324 of 2gcgA
- active site: L103 (= L97), R241 (= R229), D265 (= D253), E270 (= E258), H289 (= H276)
- binding (2r)-2,3-dihydroxypropanoic acid: S78 (≠ G72), V79 (= V73), G80 (= G74), R241 (= R229), H289 (= H276)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V79 (= V73), T107 (≠ V101), G156 (= G148), G158 (= G150), I160 (= I152), G180 (≠ D171), R181 (= R172), R184 (≠ I175), C212 (≠ T200), S213 (≠ P201), T218 (≠ N206), I239 (= I227), R241 (= R229), D265 (= D253), H289 (= H276), G291 (≠ A278)
Sites not aligning to the query:
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
32% identity, 85% coverage: 24:291/314 of query aligns to 25:291/305 of 6plfA
7dkmA Phgdh covalently linked to oridonin (see paper)
32% identity, 85% coverage: 24:290/314 of query aligns to 25:290/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ V73), A102 (≠ V101), G148 (= G148), R151 (= R151), I152 (= I152), Y170 (≠ S170), D171 (= D171), P172 (≠ R172), I173 (≠ K173), H202 (≠ C199), T203 (= T200), P204 (= P201), T209 (≠ N206), C230 (≠ I227), A231 (≠ S228), R232 (= R229), H279 (= H276), G281 (≠ A278)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 14, 17, 18, 293
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
32% identity, 85% coverage: 24:290/314 of query aligns to 24:289/303 of 6plgA
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
32% identity, 85% coverage: 24:290/314 of query aligns to 24:289/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (≠ V147), G147 (= G148), L148 (≠ M149), G149 (= G150), R150 (= R151), I151 (= I152), G152 (= G153), D170 (= D171), H201 (≠ C199), T202 (= T200), P203 (= P201)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
32% identity, 85% coverage: 24:290/314 of query aligns to 24:289/302 of 6rihA
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
32% identity, 85% coverage: 24:290/314 of query aligns to 29:294/533 of O43175
- T78 (≠ V73) binding
- R135 (≠ Q130) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (= RI 151:152) binding
- D175 (= D171) binding
- T207 (= T200) binding
- CAR 234:236 (≠ ISR 227:229) binding
- D260 (= D253) binding
- V261 (= V254) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HMAS 276:279) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
32% identity, 85% coverage: 24:291/314 of query aligns to 23:289/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (≠ L97), A100 (≠ V101), R149 (= R151), I150 (= I152), Y168 (≠ S170), D169 (= D171), P170 (≠ R172), I171 (≠ K173), H200 (≠ C199), T201 (= T200), P202 (= P201), T207 (≠ N206), C228 (≠ I227), A229 (≠ S228), R230 (= R229), H277 (= H276), G279 (≠ A278)
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
32% identity, 85% coverage: 24:290/314 of query aligns to 24:289/301 of 6rj5A
Query Sequence
>BWI76_RS27925 FitnessBrowser__Koxy:BWI76_RS27925
MKLKILKQASLPDQLTAELNSLYEVYEYEALTREELAVLAEQFTIMITNGEATVTRQLIS
SLPSLELIAVFGVGYDGVDVRAAADHRVAVSHTPGVLTDDVADLAMGLMLATSRQIVSAQ
KFIEAGGWRQGGFQWTRKVSGSRVGIVGMGRIGQAIARRCEGFAMQIAYSDRKAIPGLDY
PWIEDISTLASQTDFLVICTPGSAENQALIDERVLSALGASGILINISRGSVVDEFALIK
ALEQGIIAGAGLDVFSQEPEVPQALLRRANVVVTPHMASATWSTREAMSRLVLENVSGWA
KNKTLVTPVPALEP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory