Comparing CA265_RS00525 FitnessBrowser__Pedo557:CA265_RS00525 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q3L181 Perakine reductase; EC 1.1.1.317 from Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum) (see paper)
35% identity, 97% coverage: 4:317/323 of query aligns to 1:316/337 of Q3L181
3v0sA Crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during NADPH binding (see paper)
34% identity, 94% coverage: 4:307/323 of query aligns to 1:274/287 of 3v0sA
1pz1A Structure of NADPH-dependent family 11 aldo-keto reductase akr11b(holo) (see paper)
32% identity, 81% coverage: 9:271/323 of query aligns to 6:271/333 of 1pz1A
Sites not aligning to the query:
P80874 Aldo-keto reductase YhdN; AKR11B; General stress protein 69; GSP69; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
32% identity, 81% coverage: 9:271/323 of query aligns to 6:271/331 of P80874
Sites not aligning to the query:
P77256 NADH-specific methylglyoxal reductase; AKR11B2; EC 1.1.1.- from Escherichia coli (strain K12) (see paper)
28% identity, 92% coverage: 4:299/323 of query aligns to 1:310/326 of P77256
O14295 Pyridoxal reductase; PL reductase; PL-red; EC 1.1.1.65 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
26% identity, 94% coverage: 16:320/323 of query aligns to 9:323/333 of O14295
1pz0A Structure of NADPH-dependent family 11 aldo-keto reductase akr11a(holo) (see paper)
26% identity, 95% coverage: 6:313/323 of query aligns to 2:311/311 of 1pz0A
P46336 Aldo-keto reductase IolS; AKR11A; Vegetative protein 147; VEG147; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
26% identity, 95% coverage: 4:311/323 of query aligns to 1:310/310 of P46336
8hnqA The structure of a alcohol dehydrogenase akr13b2 with NADP
28% identity, 90% coverage: 16:307/323 of query aligns to 25:286/286 of 8hnqA
1ynqB Aldo-keto reductase akr11c1 from bacillus halodurans (holo form) (see paper)
34% identity, 66% coverage: 3:215/323 of query aligns to 1:206/298 of 1ynqB
Sites not aligning to the query:
1ynpB Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
34% identity, 66% coverage: 3:215/323 of query aligns to 1:206/298 of 1ynpB
6ow0B Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
31% identity, 81% coverage: 8:268/323 of query aligns to 5:250/301 of 6ow0B
Sites not aligning to the query:
Q9P7U2 Putative aryl-alcohol dehydrogenase C977.14c; EC 1.1.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 96% coverage: 9:317/323 of query aligns to 12:349/351 of Q9P7U2
6ow0A Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
30% identity, 81% coverage: 8:268/323 of query aligns to 5:274/323 of 6ow0A
Sites not aligning to the query:
6kiyA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor epalrestat (see paper)
27% identity, 93% coverage: 8:308/323 of query aligns to 6:273/275 of 6kiyA
6kikA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor tolrestat (see paper)
27% identity, 93% coverage: 8:308/323 of query aligns to 6:273/275 of 6kikA
5danA Crystal structure of a novel aldo keto reductase tm1743 from thermotoga maritima in complex with NADP+
27% identity, 93% coverage: 8:308/323 of query aligns to 5:272/274 of 5danA
1ynpA Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
32% identity, 66% coverage: 3:215/323 of query aligns to 1:191/283 of 1ynpA
Sites not aligning to the query:
4aubB The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
26% identity, 85% coverage: 42:315/323 of query aligns to 45:326/335 of 4aubB
Sites not aligning to the query:
5c7hA Crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 in complex with NADPH
28% identity, 93% coverage: 12:310/323 of query aligns to 12:269/281 of 5c7hA
Sites not aligning to the query:
>CA265_RS00525 FitnessBrowser__Pedo557:CA265_RS00525
MNNITKIQLGQNGPFVSKLGLGCMRMSSIWGGATPNEAESIATIHEALDRGINFLNTGDF
YGAGHNEMLIGKAIKDRLDEAFISVKFGAIFHNGQWLGLDLRPLAIKNFINYSLTRLGIE
TIDLYQPCRMDDSVPVEDIIGTVADLIKEGKVRHIGVSEITADQLRKANNTHPISALEIG
YSLADRQIESELLPAAKELGIAVVAFANTAEGLLTGEMKAPLAANDYHSHFSRFQGENLV
HNLEKVEVLKQMARDKGCTPTQLAIAWVKEQGDHIMPLVSMSRRSRLPENLKAMDIVFSP
QEMNTLNTTFAIGAIRGGTYLQR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory