SitesBLAST
Comparing CA265_RS01080 FitnessBrowser__Pedo557:CA265_RS01080 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3pefA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with NADP+ (see paper)
38% identity, 97% coverage: 5:280/285 of query aligns to 3:283/287 of 3pefA
- binding glycerol: D67 (= D69), G123 (= G125), K171 (= K173), N175 (= N177), M178 (vs. gap), L203 (= L205), G207 (≠ N209), N213 (= N215), A217 (≠ K219), F232 (= F234), H236 (= H238), K239 (= K241), R242 (≠ N244), R269 (≠ A266)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G12), I11 (≠ N13), M12 (= M14), N31 (= N33), R32 (= R34), S33 (= S35), K36 (= K38), M64 (= M66), L65 (≠ V67), A66 (≠ S68), A70 (= A72), E73 (≠ Q75), T96 (= T98), V121 (= V123), G123 (= G125), S124 (= S126), A231 (= A233), F232 (= F234), H236 (= H238), K239 (= K241)
3pduA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with NADP+ (see paper)
36% identity, 98% coverage: 4:282/285 of query aligns to 2:285/287 of 3pduA
- binding glycerol: R242 (≠ N244), E246 (≠ A248), E246 (≠ A248), R250 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), G10 (= G12), I11 (≠ N13), M12 (= M14), N31 (= N33), R32 (= R34), N33 (≠ S35), M64 (= M66), L65 (≠ V67), A66 (≠ S68), A70 (= A72), T96 (= T98), V121 (= V123), G123 (= G125), T124 (≠ S126), K171 (= K173), S231 (≠ A233), F232 (= F234), P233 (≠ A235), H236 (= H238), K239 (= K241)
3ws7A The 1.18 a resolution structure of l-serine 3-dehydrogenase complexed with NADP+ and sulfate ion from the hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
35% identity, 92% coverage: 2:263/285 of query aligns to 12:274/293 of 3ws7A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G10), L21 (= L11), G22 (= G12), I23 (≠ N13), M24 (= M14), N43 (= N33), R44 (= R34), T45 (≠ S35), K48 (= K38), M76 (= M66), V77 (= V67), S78 (= S68), D82 (≠ A72), Q85 (= Q75), V133 (= V123), F241 (= F234), K242 (≠ A235), H245 (= H238), K248 (= K241)
- binding sulfate ion: T134 (≠ S124), G135 (= G125), K183 (= K173)
3w6zA Crystal structure of NADP bound l-serine 3-dehydrogenase (k170m) from hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
33% identity, 92% coverage: 2:263/285 of query aligns to 12:277/296 of 3w6zA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G10), L21 (= L11), G22 (= G12), I23 (≠ N13), M24 (= M14), N43 (= N33), R44 (= R34), T45 (≠ S35), K48 (= K38), V77 (= V67), S78 (= S68), D82 (≠ A72), Q85 (= Q75), V133 (= V123), F244 (= F234), K245 (≠ A235), H248 (= H238), K251 (= K241)
5je8B The crystal structure of bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with NAD (see paper)
33% identity, 98% coverage: 5:283/285 of query aligns to 5:290/294 of 5je8B
P29266 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Rattus norvegicus (Rat) (see paper)
31% identity, 99% coverage: 2:282/285 of query aligns to 37:329/335 of P29266
- D68 (≠ N33) mutation to R: Decrease of activity with NAD, increase of activity with NADP.
- K208 (= K173) mutation K->A,H,N,R: Complete loss of activity.
- N212 (= N177) mutation to Q: Decrease in activity.
2uyyA Structure of the cytokine-like nuclear factor n-pac
31% identity, 97% coverage: 5:280/285 of query aligns to 8:288/292 of 2uyyA
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4s)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: G15 (= G12), L16 (≠ N13), M17 (= M14), N36 (= N33), R37 (= R34), T38 (≠ S35), V70 (= V67), S71 (= S68), A75 (= A72), T101 (= T98), F237 (= F234), Y238 (≠ A235), Y241 (≠ H238), K244 (= K241)
P31937 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Homo sapiens (Human) (see paper)
31% identity, 99% coverage: 2:282/285 of query aligns to 38:330/336 of P31937
- 40:68 (vs. 4:32, 55% identical) binding
- LP 103:104 (≠ VS 67:68) binding
- N108 (≠ A72) binding
- T134 (= T98) binding
- K284 (= K241) binding
Sites not aligning to the query:
- 1:36 modified: transit peptide, Mitochondrion
Q922P9 Cytokine-like nuclear factor N-PAC; NPAC; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Putative oxidoreductase GLYR1 from Mus musculus (Mouse) (see paper)
32% identity, 97% coverage: 5:280/285 of query aligns to 268:542/546 of Q922P9
- P489 (≠ A232) mutation to L: Mutant animals are born at expected Mendelian ratios. 54% mutants display postnatal lethality between days 0 and 1. They show centricular septal defects.
Q49A26 Cytokine-like nuclear factor N-PAC; NPAC; 3-hydroxyisobutyrate dehydrogenase-like protein; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Nuclear protein of 60 kDa; Nucleosome-destabilizing factor; hNDF; Putative oxidoreductase GLYR1 from Homo sapiens (Human) (see 3 papers)
31% identity, 97% coverage: 5:280/285 of query aligns to 269:549/553 of Q49A26
- 271:285 (vs. 7:21, 40% identical) binding
- T362 (= T98) binding
- M437 (vs. gap) mutation to K: Loss of tetramerization and protein stability.; mutation to N: No effect on tetramerization or protein stability.
- P496 (≠ A232) to L: decreased interaction with GATA4; decreased synergistic activation of GATA4 target genes transcription; detrimental effect on cardiomyocyte differentiation
- K505 (= K241) binding
Sites not aligning to the query:
- 214 D→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 214:217 Interaction with histone H3
- 216 H→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 216:225 Interaction with KDM1B
- 217 Required to promote KDM1B demethylase activity toward histone H3K4me1 and H3K4me2; F→A: Abolished stimulation of KDM1B demethylase activity, reduced affinity for histone H3 of the dimer with KDM1B, but normal KDM1B-binding.
- 219 H→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-223.
- 220:222 FLL→AAA: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity.
- 223 S→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-219.
2i9pB Crystal structure of human hydroxyisobutyrate dehydrogenase complexed with NAD+
31% identity, 97% coverage: 6:282/285 of query aligns to 3:291/296 of 2i9pB
- binding nicotinamide-adenine-dinucleotide: G9 (= G12), N10 (= N13), M11 (= M14), Y29 (= Y32), D30 (≠ N33), V31 (≠ R34), M63 (= M66), L64 (≠ V67), P65 (≠ S68), T95 (= T98), V120 (= V123), G122 (= G125), F238 (= F234), K245 (= K241)
5y8lB Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + NAD +(s)-3-hydroxyisobutyrate (s-hiba) (see paper)
30% identity, 98% coverage: 4:282/285 of query aligns to 2:288/290 of 5y8lB
- binding (2~{S})-2-methylpentanedioic acid: T129 (≠ Q134), E149 (= E154), A152 (≠ G157), G153 (≠ K158), G153 (≠ K158), K154 (≠ L159)
- binding (2S)-2-methyl-3-oxidanyl-propanoic acid: S119 (= S124), G120 (= G125), W211 (≠ F217), F236 (= F234)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G10 (= G12), N11 (= N13), M12 (= M14), F30 (≠ Y32), D31 (≠ N33), P32 (≠ R34), M64 (= M66), L65 (≠ V67), T93 (= T98), G121 (≠ S126), K168 (= K173), L240 (≠ H238), K243 (= K241)
5y8kA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + l-serine (see paper)
30% identity, 98% coverage: 4:282/285 of query aligns to 2:288/290 of 5y8kA
5y8iA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + (s)-3-hydroxyisobutyrate (s-hiba) (see paper)
30% identity, 98% coverage: 4:282/285 of query aligns to 1:287/292 of 5y8iA
5y8hA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + NAD+ (see paper)
30% identity, 98% coverage: 4:282/285 of query aligns to 1:287/291 of 5y8hA
- binding (2~{S})-2-methylpentanedioic acid: R144 (≠ K150), E148 (= E154), A151 (≠ G157), K153 (≠ L159)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G9 (= G12), N10 (= N13), M11 (= M14), F29 (≠ Y32), D30 (≠ N33), P31 (≠ R34), M63 (= M66), L64 (≠ V67), G120 (≠ S126), L239 (≠ H238), K242 (= K241)
Q8T079 Cytokine-like nuclear factor N-PAC; NPAC; Glyoxylate reductase 1 homolog; Nuclear protein NP60 homolog; Nucleosome-destabilizing factor; Putative oxidoreductase GLYR1 homolog from Drosophila melanogaster (Fruit fly) (see paper)
28% identity, 84% coverage: 6:245/285 of query aligns to 318:558/602 of Q8T079
Sites not aligning to the query:
- 8 modified: Phosphoserine
- 10 modified: Phosphoserine
- 224 modified: Phosphoserine
- 228 modified: Phosphoserine
- 243 modified: Phosphoserine
1wp4A Structure of tt368 protein from thermus thermophilus hb8 (see paper)
30% identity, 91% coverage: 5:263/285 of query aligns to 2:259/288 of 1wp4A
- active site: S116 (= S124), K164 (= K173), N167 (≠ I176), N168 (= N177)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G10), L8 (= L11), G9 (= G12), A10 (≠ N13), M11 (= M14), N29 (= N33), R30 (= R34), T31 (≠ S35), K34 (= K38), C61 (≠ M66), L62 (≠ V67), P63 (≠ S68), E67 (≠ A72), S90 (≠ T98), V115 (= V123), T225 (≠ A233), F226 (= F234), K233 (= K241)
- binding sulfate ion: S116 (= S124), G117 (= G125), G118 (≠ S126), K164 (= K173)
2cvzC Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus hb8 (see paper)
30% identity, 94% coverage: 5:271/285 of query aligns to 3:268/289 of 2cvzC
- active site: S117 (= S124), K165 (= K173), N168 (≠ I176), N169 (= N177)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), L9 (= L11), G10 (= G12), A11 (≠ N13), M12 (= M14), N30 (= N33), R31 (= R34), T32 (≠ S35), C62 (≠ M66), L63 (≠ V67), P64 (≠ S68), E68 (≠ A72), E71 (≠ Q75), S91 (≠ T98), V116 (= V123), F227 (= F234), K234 (= K241)
Q9I5I6 NAD-dependent L-serine dehydrogenase; L-serine 3-dehydrogenase (NAD(+)); EC 1.1.1.387 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
32% identity, 85% coverage: 5:245/285 of query aligns to 3:250/298 of Q9I5I6
- P66 (≠ S68) binding
- T96 (= T98) binding ; mutation to A: Almost abolished activity.
- S122 (= S124) mutation to A: Strongly reduced activity.
- K171 (= K173) active site
- N175 (= N177) mutation to A: Strongly reduced activity.
- W214 (vs. gap) mutation to A: Almost abolished activity.
- Y219 (≠ F217) mutation to A: Strongly reduced activity.
- K246 (= K241) binding ; mutation to A: Almost abolished activity.
- D247 (= D242) mutation to A: Almost abolished activity.
Sites not aligning to the query:
3q3cA Crystal structure of a serine dehydrogenase from pseudomonas aeruginosa pao1 in complex with NAD (see paper)
31% identity, 85% coverage: 5:245/285 of query aligns to 2:248/294 of 3q3cA
- binding nicotinamide-adenine-dinucleotide: G9 (= G12), H10 (≠ N13), M11 (= M14), F29 (≠ Y32), D30 (≠ N33), L31 (≠ R34), M63 (= M66), L64 (≠ V67), P65 (≠ S68), T94 (= T98), V119 (= V123), G121 (= G125), F237 (= F234), K244 (= K241)
Query Sequence
>CA265_RS01080 FitnessBrowser__Pedo557:CA265_RS01080
MNHTKIGWIGLGNMGIPMAEQLINAGYAVMVYNRSKDKEASLKEMGASIAQTPQDLITTT
DVVIVMVSDDAAIAQIFNGEGGLLRVETSGKIIINMSTVSPSISKEMAALCKANGNFYLD
APVSGSVKQAETGQLVIMVGGEEDVFNQVKPILEKMGKLAKLVGENGAGNSAKLAINSLL
ALYAQGLAETVLFANKQGIKTSDLLELINNAAIGNIFTKIKGDAIIADHYKAAFALKHIV
KDLNLAKAEGISSPLAKTALNTFGDAAAKYGEEDIIAIIKQLSGN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory