Comparing CA265_RS01810 FitnessBrowser__Pedo557:CA265_RS01810 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
P22106 Asparagine synthetase B [glutamine-hydrolyzing]; AS-B; EC 6.3.5.4 from Escherichia coli (strain K12) (see 2 papers)
30% identity, 66% coverage: 1:394/595 of query aligns to 1:376/554 of P22106
1ct9A Crystal structure of asparagine synthetase b from escherichia coli (see paper)
29% identity, 66% coverage: 4:394/595 of query aligns to 3:359/497 of 1ct9A
Sites not aligning to the query:
P78753 Probable asparagine synthetase [glutamine-hydrolyzing]; Glutamine-dependent asparagine synthetase; EC 6.3.5.4 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
29% identity, 65% coverage: 1:386/595 of query aligns to 1:389/557 of P78753
Sites not aligning to the query:
P08243 Asparagine synthetase [glutamine-hydrolyzing]; Cell cycle control protein TS11; Glutamine-dependent asparagine synthetase; EC 6.3.5.4 from Homo sapiens (Human) (see 7 papers)
26% identity, 64% coverage: 1:378/595 of query aligns to 1:379/561 of P08243
Sites not aligning to the query:
6gq3A Human asparagine synthetase (asns) in complex with 6-diazo-5-oxo-l- norleucine (don) at 1.85 a resolution (see paper)
27% identity, 63% coverage: 2:378/595 of query aligns to 1:366/509 of 6gq3A
P00497 Amidophosphoribosyltransferase; ATase; Glutamine phosphoribosylpyrophosphate amidotransferase; GPATase; EC 2.4.2.14 from Bacillus subtilis (strain 168) (see 5 papers)
32% identity, 18% coverage: 64:168/595 of query aligns to 96:209/476 of P00497
Sites not aligning to the query:
1gph1 Structure of the allosteric regulatory enzyme of purine biosynthesis (see paper)
32% identity, 18% coverage: 64:168/595 of query aligns to 85:198/465 of 1gph1
Sites not aligning to the query:
1ao0A Glutamine phosphoribosylpyrophosphate (prpp) amidotransferase from b. Subtilis complexed with adp and gmp (see paper)
32% identity, 18% coverage: 64:168/595 of query aligns to 81:194/455 of 1ao0A
Sites not aligning to the query:
Q9STG9 Amidophosphoribosyltransferase 2, chloroplastic; AtATase2; AtPURF2; PRPP2; Glutamine phosphoribosylpyrophosphate amidotransferase 2; AtGPRAT2; Protein CHLOROPLAST IMPORT APPARATUS 1; Protein DIFFERENTIAL DEVELOPMENT OF VASCULAR ASSOCIATED CELLS; EC 2.4.2.14 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
33% identity, 16% coverage: 75:168/595 of query aligns to 185:285/561 of Q9STG9
Sites not aligning to the query:
6lbpA Structure of the glutamine phosphoribosylpyrophosphate amidotransferase from arabidopsis thaliana (see paper)
33% identity, 16% coverage: 75:168/595 of query aligns to 99:199/460 of 6lbpA
Sites not aligning to the query:
P14742 Glutamine--fructose-6-phosphate aminotransferase [isomerizing]; GFAT; D-fructose-6-phosphate amidotransferase; Hexosephosphate aminotransferase; EC 2.6.1.16 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
45% identity, 8% coverage: 64:113/595 of query aligns to 100:150/717 of P14742
Sites not aligning to the query:
>CA265_RS01810 FitnessBrowser__Pedo557:CA265_RS01810
MCRIAGIINSKNSFEKVNQQVKAMCDSMQHGGPDDHGIYTAEKTPLCLGNRRLAILDLSS
TGHQPMLSHKEDLVITYNGEIYNYKQIRTELINLGYIFKTQTDTEVILYAYQHWGETAFE
KLDGIFAFCIFDKREQCVYLVRDQNGIKPLYYHFANETLTFASEVKAFKHANIDQENDNW
RIYYLAFGHIPEPYTTLKNVCSLGKGSFLKYNIRSAQHLIQSYHEFESTSYIHNESYAIE
RIREQLGHSIKQQMISDVDIGVLFSGGLDSSIITILANQYNNKQLSSISANFNEIDFSEK
KQRNSLLQKINLQKIEQLITYRDFVQNFETVLADMDQPTNDGINTWFVCKTAKANGIKVV
LSGLGADELFGGYPSFDRIHKIQNLNWLSKSALRSTRFSNNTKFKRLYYLSLNSPIGEYL
CLRGVYSPDVIAELLDIDMKTVIDCLEDIPLHPGIKKTSNETRASWFEFNMYMQNQLLKD
TDFMSMSHGVEVRVPFLDRNFVDLVLSISTEIKFSYEQKKKLLVEAYKEDLPVETWKRSK
MGFTFPFQEWMRKSSDIADPSRYANKRAKSLMQNFGENKLHWSSALALYRIYHAS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory